PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010552064.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 136aa MW: 14877.5 Da PI: 4.8747 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 65.3 | 1.3e-20 | 20 | 71 | 2 | 55 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 +y+GVr ++ +g+++AeIrd +g+ +r++lg+f+taeeAa+a+++a+ +++g XP_010552064.1 20 KYRGVRKRP-WGKYAAEIRDS-GRGQGARVWLGTFDTAEEAAQAYDRAAYAMRG 71 8********.**********3.34456*************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00018 | 2.48E-29 | 20 | 79 | No hit | No description |
PROSITE profile | PS51032 | 23.196 | 20 | 79 | IPR001471 | AP2/ERF domain |
SMART | SM00380 | 1.1E-33 | 20 | 85 | IPR001471 | AP2/ERF domain |
Gene3D | G3DSA:3.30.730.10 | 7.8E-30 | 20 | 80 | IPR001471 | AP2/ERF domain |
Pfam | PF00847 | 2.4E-15 | 20 | 71 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 1.57E-21 | 20 | 80 | IPR016177 | DNA-binding domain |
PRINTS | PR00367 | 8.0E-12 | 21 | 32 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 8.0E-12 | 45 | 61 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MEDNNMEHNE VNKTTTGEVK YRGVRKRPWG KYAAEIRDSG RGQGARVWLG TFDTAEEAAQ 60 AYDRAAYAMR GSLAILNFPR DYSAGKLPGE SIHGGDVAAG AGVGKEVIEF ECLDDRLLEE 120 LLEHGECIGK GNSNKD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5wx9_A | 2e-31 | 20 | 117 | 14 | 114 | Ethylene-responsive transcription factor ERF096 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010552064.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010552064.1 | 6e-97 | PREDICTED: ethylene-responsive transcription factor ERF095-like | ||||
Swissprot | Q9LTC5 | 4e-32 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
TrEMBL | A0A2G9I9T0 | 2e-43 | A0A2G9I9T0_9LAMI; Uncharacterized protein | ||||
STRING | XP_010552064.1 | 2e-96 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10 | 28 | 1650 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23220.1 | 4e-24 | ERF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|