PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010551470.1

Organism

Tarenaya hassleriana

Taxonomic ID

28532

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya

Family

MYB_related

Protein Properties

Length: 139aa MW: 15871 Da PI: 9.2495

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010551470.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.9	3.2e-15	4	49	2	47
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++WT+eE+ +++++ +lG+g+W++I+r +Rt+ q+ s+ qky XP_010551470.1 4 NPWTEEEHMRFLRGLDELGKGDWRAISRNYVVTRTPTQVASHAQKY 49 69*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	18.625	1	54	IPR017930	Myb domain
SMART	SM00717	1.1E-10	2	52	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.05E-15	4	54	IPR009057	Homeodomain-like
Pfam	PF00249	4.8E-13	4	49	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.7E-11	4	48	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.5E-17	5	52	IPR006447	Myb domain, plants
CDD	cd00167	8.23E-11	5	50	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 139 aa Download sequence Send to blast
MRGNPWTEEE HMRFLRGLDE LGKGDWRAIS RNYVVTRTPT QVASHAQKYF LRLNCLNNRR 60 RRGSSLFDIT IDSVTISRQE KPMVFPVIGE SSQTPIRMFQ PPVLRISDLS LNDRPPELFL 120 SLAMPSSPSS SDEPNPVDA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:22773748}.
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250\|UniProtKB:Q8LH59}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010551470.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269\|PubMed:12172034}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010551470.1	8e-99	PREDICTED: transcription factor MYB1R1 isoform X2
Swissprot	B8A9B2	3e-29	MYBS1_ORYSI; Transcription factor MYBS1
Swissprot	Q8LH59	3e-29	MYBS1_ORYSJ; Transcription factor MYBS1
TrEMBL	V7CAD3	4e-32	V7CAD3_PHAVU; Uncharacterized protein
STRING	XP_010551469.1	2e-90	(Tarenaya hassleriana)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G70000.2	1e-27	MYB_related family protein

Publications ? help Back to Top
Hong YF, et al. Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals. Plant Cell, 2012. 24(7): p. 2857-73 [PMID:22773748]