PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010547620.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 199aa MW: 22385.5 Da PI: 8.464 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 72.5 | 3.5e-23 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienks rqvtfskRr+g+ KA LSvLCda vav+++ss+gk y +ss XP_010547620.1 9 KRIENKSSRQVTFSKRRTGLVEKARQLSVLCDAAVAVLVVSSSGKHYSFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 35.9 | 3.2e-13 | 101 | 163 | 35 | 97 |
K-box 35 qRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 + +l +L++ ++ L q+e+qLe +l+ R++K++l++e+++ + kek+l+ en++L + XP_010547620.1 101 NSQLEEPNLGNVNIDFLIQMEHQLEVALSVARARKTQLMMESLKAFKGKEKSLRVENQRLAGQ 163 555555689999**********************************************99866 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.777 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.2E-33 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.75E-26 | 2 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.1E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.1E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.1E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.803 | 80 | 175 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.1E-9 | 96 | 163 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010048 | Biological Process | vernalization response | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MGRKKMEIKR IENKSSRQVT FSKRRTGLVE KARQLSVLCD AAVAVLVVSS SGKHYSFSSG 60 DSLTRILGLY REKQADEDLK ALDRLESGNY LSHKELLEIV NSQLEEPNLG NVNIDFLIQM 120 EHQLEVALSV ARARKTQLMM ESLKAFKGKE KSLRVENQRL AGQFGGPILV EEEADKATTS 180 ENNSGEEHQQ PQETLRLLT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 5e-16 | 1 | 72 | 1 | 71 | MEF2C |
5f28_B | 5e-16 | 1 | 72 | 1 | 71 | MEF2C |
5f28_C | 5e-16 | 1 | 72 | 1 | 71 | MEF2C |
5f28_D | 5e-16 | 1 | 72 | 1 | 71 | MEF2C |
6byy_A | 4e-16 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6byy_B | 4e-16 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6byy_C | 4e-16 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6byy_D | 4e-16 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6bz1_A | 5e-16 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6bz1_B | 5e-16 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6bz1_C | 5e-16 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
6bz1_D | 5e-16 | 1 | 72 | 1 | 71 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. Landsberg erecta than in cv. Columbia background. Prevents premature flowering (PubMed:12724541, PubMed:25339407). Involved in the modulation of vernalization impact on flowering according to genotype acclimation to altitude (PubMed:25339407). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:25339407}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010547620.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed during vernalization (PubMed:12724541). Regulated by HAM1 and HAM2 via epigenetic modification of chromatins at H4K5 acetylation during flowering (PubMed:23273925). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:23273925}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010547620.1 | 1e-143 | PREDICTED: agamous-like MADS-box protein AGL27 | ||||
Swissprot | Q9LSR7 | 4e-68 | AGL70_ARATH; Agamous-like MADS-box protein AGL70 | ||||
TrEMBL | A0A087GE89 | 1e-70 | A0A087GE89_ARAAL; Uncharacterized protein | ||||
STRING | XP_010547620.1 | 1e-142 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM986 | 19 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65060.1 | 3e-52 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|