PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010542875.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 230aa MW: 26191.8 Da PI: 9.8173 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.8 | 2.2e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien +nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ XP_010542875.1 9 KRIENATNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 58 79***********************************************8 PP | |||||||
2 | K-box | 101.1 | 1.5e-33 | 76 | 173 | 3 | 100 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +++++s++e +a+++qqe+akL+++i++Lq+++R+l+G++L+sLs+keL+ Le++Lek++++iRskK+elll++ie lqk+e el++e +Lr++ XP_010542875.1 76 STNTSSVQEINAAYYQQESAKLRQQIQMLQNSNRNLMGDSLSSLSVKELKTLENRLEKAMSRIRSKKHELLLAEIEFLQKREMELDNEGIYLRTR 170 45556699*************************************************************************************99 PP K-box 98 lee 100 ++e XP_010542875.1 171 IAE 173 986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 34.118 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.3E-43 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.62E-33 | 2 | 81 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.77E-43 | 2 | 76 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.2E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.2E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.2E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.1E-24 | 86 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.594 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MGRGKIEIKR IENATNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYANN 60 NIRSTIERYK KACSDSTNTS SVQEINAAYY QQESAKLRQQ IQMLQNSNRN LMGDSLSSLS 120 VKELKTLENR LEKAMSRIRS KKHELLLAEI EFLQKREMEL DNEGIYLRTR IAEVERLQQH 180 HSMVSGQEIN AIEALASRNF FGHNLIGSGA STSTGAAYSD LQDKRTLHLG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor (Probable). Is required, together with TT16/AGL32 for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). {ECO:0000269|PubMed:22176531, ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010542875.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010542871.1 | 1e-167 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
Swissprot | Q38836 | 1e-134 | AGL11_ARATH; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | C1IDW9 | 1e-133 | C1IDW9_CAPBU; SEEDSTICK-like protein | ||||
STRING | XP_010542871.1 | 1e-167 | (Tarenaya hassleriana) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-136 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|