PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010541770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family ARF
Protein Properties Length: 624aa    MW: 70536.2 Da    PI: 6.4689
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010541770.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.35.4e-22131230197
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f kvlt sd++++g +++ +++a+++     +++++ +++l+ +d++g +W++k+ +r++++r++lt+GW+ Fv +++L +gD++v    +++++
  XP_010541770.1 131 FSKVLTASDTSTHGGFSVLRRHAKKClppldMSQPNPTQELVARDLHGCEWKFKHVFRGQPRRHLLTSGWSTFVTSKKLVAGDTFVCL--REENG 223
                     88****************************9666667779**********************************************99..55899 PP

                     ..EEEEE CS
              B3  91 elvvkvf 97 
                     +l+v+v 
  XP_010541770.1 224 KLRVGVS 230
                     9999986 PP

2Auxin_resp104.61.2e-34256335183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t+++F+v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds  r++sGtvv v+d++p +W +SkWr+L+
  XP_010541770.1 256 ASHAIHTQTMFTVFYKPRT--SQFIISLNKYLEAINNKFSVGMRFKMRFEGEDSLLRSYSGTVVTVNDCSP-HWIDSKWRCLE 335
                     789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.92E-36124259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-35125243IPR015300DNA-binding pseudobarrel domain
CDDcd100171.06E-19129229No hitNo description
SMARTSM010192.9E-21131233IPR003340B3 DNA binding domain
PROSITE profilePS5086311.279131233IPR003340B3 DNA binding domain
PfamPF023622.3E-19131229IPR003340B3 DNA binding domain
PfamPF065073.7E-31256334IPR010525Auxin response factor
PfamPF023093.4E-5514568IPR033389AUX/IAA domain
SuperFamilySSF542777.36E-12531607No hitNo description
PROSITE profilePS5174526.238532612IPR000270PB1 domain
PfamPF023095.6E-7577619IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MENRGGAFLH SDIHLGGDDC GGGYLHEVLW KLCAGPLVDV PRRDDFVYYF PQGHMEQLEA  60
STNQDLNQMK PLFDLPAKIL CRVINVILQV EKDTDEVYSQ ITLLPTGTQV DKPTCPDPCV  120
PAPQRPTVHS FSKVLTASDT STHGGFSVLR RHAKKCLPPL DMSQPNPTQE LVARDLHGCE  180
WKFKHVFRGQ PRRHLLTSGW STFVTSKKLV AGDTFVCLRE ENGKLRVGVS HAVRQQSMPS  240
SMISGQSMHL GVLATASHAI HTQTMFTVFY KPRTSQFIIS LNKYLEAINN KFSVGMRFKM  300
RFEGEDSLLR SYSGTVVTVN DCSPHWIDSK WRCLEVQWDE PALISRPDRV SPWEIKSFVP  360
SSGNAAQSVT LNNKRPWQVS EVSGFDLGSA TSNLWNSTLT HSHELNQSCI TYQTSPSEHC  420
YLDTTKNAYE WLMNCCYPVP PREILTDDRM VFSGEEKRPE AVRLFGIDLV SNSTPATPAV  480
EKTTHVLPIH PTVEAESDHK SEVSKVSEEK NNRQERMQEV VWLKEVQSKQ NRSRTKVKMQ  540
GVGVGRGVEL SAMEGYDELI EELERLFDIR GGGLRDEWEI VYMDDEGDMM LVGDDPWPEF  600
CSMVKRIFIC SKDDVKRLSP IVLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1502235612353Auxin response factor 1
4ldw_A1e-1502235612353Auxin response factor 1
4ldw_B1e-1502235612353Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010541770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010541770.10.0PREDICTED: auxin response factor 9-like isoform X1
RefseqXP_010541775.10.0PREDICTED: auxin response factor 9-like isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLV4P5Z30.0V4P5Z3_EUTSA; Auxin response factor
STRINGXP_010541770.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9