PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010538837.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family ARF
Protein Properties Length: 636aa    MW: 71936.3 Da    PI: 6.6951
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010538837.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.74e-22117217198
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f kvlt sd++++g +++ +k+a+e+       +  +  +++l+  d+ g++W++k+i+r++++r++lt+GW+ Fv+ ++L +gD++vF   + +
  XP_010538837.1 117 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--PIPTQELVASDLLGNEWKFKHIFRGQPRRHLLTTGWSTFVSLKRLVAGDTFVFL--RGE 207
                     88****************************9543..444558************************************************..449 PP

                     EE..EEEEE- CS
              B3  89 efelvvkvfr 98 
                     ++el+v+++ 
  XP_010538837.1 208 NGELRVGIRH 217
                     9999***986 PP

2Auxin_resp111.21e-36243321182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     a ha++t++ F+v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds+err+sGtvvgv+d+++ +W++S+Wr+L
  XP_010538837.1 243 ARHAIHTQTRFTVYYKPRT--SQFIISLNKYLEAMNNKFSVGMRFKMRFEGEDSPERRFSGTVVGVKDCSS-HWKDSEWRCL 321
                     679***************6..9**********************************************887.*********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.22E-35106246IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.6E-38112231IPR015300DNA-binding pseudobarrel domain
CDDcd100172.98E-18115216No hitNo description
PfamPF023625.7E-20117217IPR003340B3 DNA binding domain
SMARTSM010191.7E-18117219IPR003340B3 DNA binding domain
PROSITE profilePS5086311.801117219IPR003340B3 DNA binding domain
PfamPF065071.3E-33243321IPR010525Auxin response factor
PfamPF023092.1E-12495604IPR033389AUX/IAA domain
SuperFamilySSF542772.16E-13510592No hitNo description
PROSITE profilePS5174526.092516599IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MANRGDDGGG GGYLYEELWK LCAGPLVDIP RRNEKVYYFP QGHMEQLEAS TNEDLNKMEP  60
LFNLPSKILC RVMNVILQAE KETDEVYAQI TLIPIGTQVD DEHTCPPEPQ KATVHSFSKV  120
LTASDTSTHG GFSVLRKHAT ECLPPLDMTQ PIPTQELVAS DLLGNEWKFK HIFRGQPRRH  180
LLTTGWSTFV SLKRLVAGDT FVFLRGENGE LRVGIRHAAR QQISMPSSVI SGQSLHLGVL  240
ATARHAIHTQ TRFTVYYKPR TSQFIISLNK YLEAMNNKFS VGMRFKMRFE GEDSPERRFS  300
GTVVGVKDCS SHWKDSEWRC LRVQWDEPTS IQRHDNVSPW EIEPFVPSTN ITQSVVPKNK  360
RPRQASEVSG LDLGSTRPNL WSSTLTQSHE FGQSCITSQH CYRDAAEETK SVSGWLMNCY  420
SVPPTTKSTN DQMGFPVEEK KHEMVTSYRL FGIDLMSKSA ATEKTGNMLT VNIANSTLEA  480
VSDQKSEVSK VSEEKKQEHA QASPKEVQSK QNSSNRSRTK VQMQGVGVGR AVDLTVVEGY  540
DQLFEELEKL FDIRCELRTR DRWEIVYTDG EGDMMLVGDD PWHEFCNMVK RIFIWSKEDV  600
KKMTPGSKLP LFIPEGRDDQ TMTMLASSDS ADTNTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-16223453355Auxin response factor 1
4ldw_A1e-16223453355Auxin response factor 1
4ldw_B1e-16223453355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010538837.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010538837.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLV4P5Z30.0V4P5Z3_EUTSA; Auxin response factor
STRINGXP_010538837.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9