PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010530322.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 234aa MW: 27373.8 Da PI: 8.9473 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.3 | 6.5e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvt+skRrng++KKA+ELS+LCda+v+vi+fss++kl+ey s XP_010530322.1 9 KRIENQTNRQVTYSKRRNGLFKKAHELSILCDARVSVIMFSSSNKLHEYTS 59 79***********************************************75 PP | |||||||
2 | K-box | 69.3 | 1.2e-23 | 71 | 169 | 1 | 99 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 yqk+sg++ +++++e++q+ ++L + ++nL+++++++lGe+L++L++++L++Le+++e+ + +R+kK + + ++ie+++kk+k++++++k+L XP_010530322.1 71 YQKASGVDIWASHYERMQEIKKQLLETNRNLRKQIKQRLGECLDELEINDLRRLEEEMENTTNLVRTKKFKSIGNKIETTKKKNKSQEDIQKTLI 165 899*******************************************************************************************9 PP K-box 96 kkle 99 ++le XP_010530322.1 166 HELE 169 9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.2E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.127 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.58E-37 | 2 | 94 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.2E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.82E-41 | 3 | 80 | No hit | No description |
Pfam | PF00319 | 3.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.2E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.2E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.7E-13 | 82 | 168 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.759 | 84 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MTRGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELSILCD ARVSVIMFSS SNKLHEYTSP 60 NTSTKEIIDM YQKASGVDIW ASHYERMQEI KKQLLETNRN LRKQIKQRLG ECLDELEIND 120 LRRLEEEMEN TTNLVRTKKF KSIGNKIETT KKKNKSQEDI QKTLIHELEL RAEDPHYGLV 180 DNGGDYESVL GYHQIEGSRA YALHFHQNHH HYHNQSSLHD GASASDLITF HLLE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 4e-18 | 3 | 61 | 2 | 60 | Myocyte-specific enhancer factor 2A |
3mu6_B | 4e-18 | 3 | 61 | 2 | 60 | Myocyte-specific enhancer factor 2A |
3mu6_C | 4e-18 | 3 | 61 | 2 | 60 | Myocyte-specific enhancer factor 2A |
3mu6_D | 4e-18 | 3 | 61 | 2 | 60 | Myocyte-specific enhancer factor 2A |
6byy_A | 4e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_B | 4e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_C | 4e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_D | 4e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_A | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_B | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_C | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_D | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00077 | ChIP-seq | Transfer from AT3G54340 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010530322.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010530322.1 | 1e-174 | PREDICTED: floral homeotic protein APETALA 3-like isoform X1 | ||||
Swissprot | P35632 | 1e-142 | AP3_ARATH; Floral homeotic protein APETALA 3 | ||||
TrEMBL | A0A178VHZ2 | 1e-140 | A0A178VHZ2_ARATH; ATAP3 | ||||
STRING | XP_010530322.1 | 1e-173 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5261 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 1e-129 | MIKC_MADS family protein |