PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529646.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family ARF
Protein Properties Length: 655aa    MW: 73142.8 Da    PI: 6.5739
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529646.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.46.6e-24136235197
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f kvlt sd++++g +++ +k+a+e+     + +++ +++l+ +d +g++W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +++
  XP_010529646.1 136 FSKVLTASDTSTHGGFSVLRKHATEClppldMTQPTPTQELVTRDIHGQEWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RGENG 228
                     88****************************9666667789************************************************..44999 PP

                     ..EEEEE CS
              B3  91 elvvkvf 97 
                     el+v+v+
  XP_010529646.1 229 ELRVGVR 235
                     99**997 PP

2Auxin_resp110.91.3e-36262341183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t++ F+v+Y+Pr+  s+F+v+++k+++al++k+svGmRfkm+fe+eds+err+sGtvvgv+d++p +W +SkWr+L+
  XP_010529646.1 262 ASHAIHTQTRFTVYYKPRT--SQFIVSLNKYVEALNNKFSVGMRFKMRFEGEDSPERRFSGTVVGVNDCSP-HWIDSKWRCLE 341
                     789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.4E-37129265IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-40130251IPR015300DNA-binding pseudobarrel domain
CDDcd100171.01E-20134236No hitNo description
PROSITE profilePS5086312.449136238IPR003340B3 DNA binding domain
SMARTSM010192.8E-21136238IPR003340B3 DNA binding domain
PfamPF023621.4E-21136235IPR003340B3 DNA binding domain
PfamPF065072.8E-33262340IPR010525Auxin response factor
PfamPF023091.6E-7521578IPR033389AUX/IAA domain
SuperFamilySSF542771.08E-13536618No hitNo description
PROSITE profilePS5174526.62542623IPR000270PB1 domain
PfamPF023093.4E-6591623IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MANRGGAFIQ PVSFPGGVFG QPDDGGGGYL YEELWKLCAG PLVDVPRPEE NVYYFPQGHM  60
EQLEASTNQD LNKMKPLLNL PSKILCRVMN VTLQAEKETD EVYAQITLIP IGTQADESTC  120
RDPCPPAPQR STIHSFSKVL TASDTSTHGG FSVLRKHATE CLPPLDMTQP TPTQELVTRD  180
IHGQEWKFKH IFRGQPRRHL LTTGWSTFVT SKRLVAGDSF VFLRGENGEL RVGVRCAARQ  240
QSSMPSSVIS SQSMHLGVLA TASHAIHTQT RFTVYYKPRT SQFIVSLNKY VEALNNKFSV  300
GMRFKMRFEG EDSPERRFSG TVVGVNDCSP HWIDSKWRCL EVQWDEPSSI LRPDRVSPWE  360
IEPFVPSSAN IAQSVAPKNK RPRQVNEVSS LDLGSPAPNL WSSTLTQSQS HVFAQSCITS  420
QMSGSQHCYR DATEDTKSVS DWLMNRYSIP PMAKLNNEQL GFPVEEKKPE TVTSYKLFGI  480
DLMSNSTPAT PVEKTTNALP INISSPTVEA GSEQKSEVSK DSKEKTQVSP KEVQSKQNSS  540
SRSCIKVQMK GVAVGRAVDL TVLEGYYQLF DELEKLFDIR GELRPRNLWE IVYTDDEGDM  600
MLVGDDPWTE FCKMAKRIFI CSKEDVKKMN TGDKLPILSD GGEAASLPSS DNMWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1641536411355Auxin response factor 1
4ldw_A1e-1641536411355Auxin response factor 1
4ldw_B1e-1641536411355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010529646.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794741e-31JN979474.1 Brassica rapa subsp. pekinensis auxin response factor 9 (ARF9-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529646.10.0PREDICTED: auxin response factor 9-like isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLV4P5Z30.0V4P5Z3_EUTSA; Auxin response factor
STRINGXP_010529646.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9