PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010528773.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 165aa MW: 19096.8 Da PI: 9.3439 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 182.3 | 1.2e-56 | 16 | 143 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdee++++yL++kv ++k+++ ++ e+d++++ePwdL++k+k +ekewyfF+++d+ky+tg r+nrat+sgyWkatgkdke+++ XP_010528773.1 16 LPPGFRFHPTDEEIITCYLTEKVMNSKFSA-AAVGEADLNRCEPWDLHEKAKMGEKEWYFFCQKDRKYPTGMRTNRATESGYWKATGKDKEIFRG 109 79*************************999.78**************999999****************************************** PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrle 129 kg lvg++ktLvfykgrapkgekt+Wvmheyrle XP_010528773.1 110 KGYLVGMRKTLVFYKGRAPKGEKTNWVMHEYRLE 143 ********************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.44E-59 | 11 | 149 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.921 | 16 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.8E-30 | 17 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MEEIENNSKG GGLVDLPPGF RFHPTDEEII TCYLTEKVMN SKFSAAAVGE ADLNRCEPWD 60 LHEKAKMGEK EWYFFCQKDR KYPTGMRTNR ATESGYWKAT GKDKEIFRGK GYLVGMRKTL 120 VFYKGRAPKG EKTNWVMHEY RLEGNLPFPN LNRFSKVSKN HNVVC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-49 | 14 | 142 | 15 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-49 | 14 | 142 | 15 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-49 | 14 | 142 | 15 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-49 | 14 | 142 | 15 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-49 | 14 | 142 | 18 | 145 | NAC domain-containing protein 19 |
3swm_B | 1e-49 | 14 | 142 | 18 | 145 | NAC domain-containing protein 19 |
3swm_C | 1e-49 | 14 | 142 | 18 | 145 | NAC domain-containing protein 19 |
3swm_D | 1e-49 | 14 | 142 | 18 | 145 | NAC domain-containing protein 19 |
3swp_A | 1e-49 | 14 | 142 | 18 | 145 | NAC domain-containing protein 19 |
3swp_B | 1e-49 | 14 | 142 | 18 | 145 | NAC domain-containing protein 19 |
3swp_C | 1e-49 | 14 | 142 | 18 | 145 | NAC domain-containing protein 19 |
3swp_D | 1e-49 | 14 | 142 | 18 | 145 | NAC domain-containing protein 19 |
4dul_A | 1e-49 | 14 | 142 | 15 | 142 | NAC domain-containing protein 19 |
4dul_B | 1e-49 | 14 | 142 | 15 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010528773.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010528773.1 | 1e-122 | PREDICTED: NAC domain-containing protein 59-like | ||||
Swissprot | Q9FK44 | 1e-87 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
TrEMBL | B9SHJ6 | 1e-87 | B9SHJ6_RICCO; NAC domain-containing protein 21/22, putative | ||||
STRING | XP_010528773.1 | 1e-121 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM400 | 28 | 174 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G18270.2 | 2e-90 | Arabidopsis NAC domain containing protein 87 |
Publications ? help Back to Top | |||
---|---|---|---|
|