PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010525336.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 255aa MW: 29649.4 Da PI: 9.5548 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.2 | 6.9e-31 | 37 | 86 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLC+aeva+iifss+g+lyey+ XP_010525336.1 37 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIIFSSRGRLYEYA 86 79***********************************************8 PP | |||||||
2 | K-box | 105.2 | 7.9e-35 | 108 | 201 | 7 | 100 |
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 s++e +++++qqe++kL+++i+ +q+ +R++lGe+L+sL++k+L++Le++Lek++ +iRskKnelll++ie++qk+ +elq+e+ Lr+k++e XP_010525336.1 108 PSVNEINTQYYQQEASKLRRQIRDIQNMNRNILGESLGSLNFKDLKNLESRLEKGIARIRSKKNELLLSEIEYMQKRGNELQSETFFLREKIAE 201 4488999************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.319 | 29 | 89 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.6E-40 | 29 | 88 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.40E-43 | 30 | 103 | No hit | No description |
SuperFamily | SSF55455 | 2.22E-32 | 30 | 103 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-32 | 31 | 51 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 31 | 85 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-25 | 38 | 85 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-32 | 51 | 66 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-32 | 66 | 87 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.9E-25 | 114 | 199 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.358 | 115 | 205 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 255 aa Download sequence Send to blast |
MQQLSVGDKV MNMEMAKNEA ESSNNTKKIG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA 60 YELSVLCEAE VALIIFSSRG RLYEYANSSV RGTIERYKKA SSDAVNPPSV NEINTQYYQQ 120 EASKLRRQIR DIQNMNRNIL GESLGSLNFK DLKNLESRLE KGIARIRSKK NELLLSEIEY 180 MQKRGNELQS ETFFLREKIA ENERFQQEQE QQQQQQGAVY ESHESQQYNR SYIPVNLLEP 240 NQQFSGQDQP PLQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
5f28_A | 4e-20 | 29 | 97 | 1 | 69 | MEF2C |
5f28_B | 4e-20 | 29 | 97 | 1 | 69 | MEF2C |
5f28_C | 4e-20 | 29 | 97 | 1 | 69 | MEF2C |
5f28_D | 4e-20 | 29 | 97 | 1 | 69 | MEF2C |
6byy_A | 5e-20 | 29 | 101 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 5e-20 | 29 | 101 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 5e-20 | 29 | 101 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 5e-20 | 29 | 101 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-20 | 29 | 101 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010525336.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010525336.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL1 isoform X2 | ||||
Swissprot | P29381 | 1e-132 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
TrEMBL | A0A347Z9M0 | 1e-131 | A0A347Z9M0_MATIN; MADS box transcription factor | ||||
STRING | XP_010525329.1 | 1e-173 | (Tarenaya hassleriana) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.1 | 1e-121 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|