PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010521856.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family TCP
Protein Properties Length: 265aa    MW: 27261.3 Da    PI: 10.5886
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010521856.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.42.6e-3833118288
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                     a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++a+ s+  ++ +s +
  XP_010521856.1  33 AVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTASVSVRGGG-NSTS 118
                     78*******************************************************************8884433333333.3332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.2093993IPR017887Transcription factor TCP subgroup
PfamPF036341.2E-3339135IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MSNPDGAGNA VSNGAMIDRH RQNSTSAGNG ALAVKKPPSK DRHSKVDGRG RRIRMPIICA  60
ARVFQLTREL GHKSDGQTIE WLLRQAEPSI IAATGTGTTP ASFSTASVSV RGGGNSTSLS  120
SFSSLDHKPL SGPAPFILGK RVRAEEDSGG GGKDDGGVTS VGHTMGSFVG SASPAGFWAV  180
PARPDFGQFW SFAAAAGAPP EMVLQSASIT QQTAALFVHQ QQQAAAAMGE ASAARVGNYL  240
PGHLNLLASL SGGTAGSNRR EDDPR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010521856.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010521856.10.0PREDICTED: transcription factor TCP7
SwissprotQ9FMX21e-108TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A1J3E1H41e-118A0A1J3E1H4_NOCCA; Transcription factor TCP7 (Fragment)
STRINGXP_010521856.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.11e-75TCP family protein