PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG029699t1 | ||||||||
Common Name | TCM_029699 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 170aa MW: 18897.5 Da PI: 9.358 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 124.2 | 4.2e-39 | 41 | 99 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k Thecc1EG029699t1 41 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAKP 99 68999***************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 8.0E-30 | 40 | 98 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 4.3E-32 | 43 | 98 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.258 | 45 | 99 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 47 | 83 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MVMASQEGQG IKLFGTTIAL HGRQVKEEQN KADHPALDKR PDKIIPCPRC KSMETKFCYF 60 NNYNVNQPRH FCKGCQRYWT AGGALRNVPV GAGRRKAKPP GRDLGGFAEG CLYDGSSGVH 120 QFELEGMALD EWQVAAANGG FRQIFPMKRR RISCSGQNQP TEESMIQFN* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 147 | 151 | KRRRI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX616238 | 2e-76 | JX616238.1 Gossypium hirsutum clone NBRI_GE60732 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007025382.1 | 1e-126 | PREDICTED: dof zinc finger protein DOF1.5 isoform X1 | ||||
Swissprot | O22967 | 2e-63 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A061GLN0 | 1e-124 | A0A061GLN0_THECC; Dof-domain transcription factor protein | ||||
STRING | EOY28004 | 1e-125 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2809 | 26 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 9e-66 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG029699t1 |
Entrez Gene | 18596691 |
Publications ? help Back to Top | |||
---|---|---|---|
|