PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG029315t2 | ||||||||
Common Name | TCM_029315 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 121aa MW: 13233.2 Da PI: 8.7632 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 148.4 | 1.8e-46 | 13 | 112 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++ Thecc1EG029315t2 13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQTQ 105 7******************************************************************************************** PP DUF260 94 lallkee 100 lal+++e Thecc1EG029315t2 106 LALAQAE 112 **99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.511 | 12 | 113 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.7E-46 | 13 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MKESGRKQGA ASPCAACKLL RRRCAQDCVF APYFPADEPQ KFANVHKVFG ASNVNKMLQE 60 LPVHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID ALQTQLALAQ AEVVHLRRFE 120 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-51 | 9 | 114 | 7 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-51 | 9 | 114 | 7 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007024851.1 | 1e-84 | PREDICTED: LOB domain-containing protein 4 isoform X2 | ||||
Swissprot | Q9SHE9 | 8e-72 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A061GDI0 | 2e-83 | A0A061GDI0_THECC; LOB domain-containing protein 4 isoform 2 | ||||
STRING | EOY27472 | 3e-81 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 2e-67 | LOB domain-containing protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG029315t2 |
Entrez Gene | 18596365 |
Publications ? help Back to Top | |||
---|---|---|---|
|