PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG029126t1 | ||||||||
Common Name | TCM_029126 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 200aa MW: 22989 Da PI: 8.4787 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.2 | 1.9e-18 | 23 | 70 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l+++++ +G ++Wk Ia + g++R++k+c++rw +yl Thecc1EG029126t1 23 KGAWTAEEDRKLAEVIAVHGAKRWKIIAIKAGLNRCGKSCRLRWMNYL 70 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.8 | 3.9e-16 | 76 | 121 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Thecc1EG029126t1 76 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 121 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.669 | 18 | 74 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.71E-29 | 21 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-15 | 22 | 72 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-17 | 23 | 70 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-24 | 24 | 77 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.10E-10 | 25 | 70 | No hit | No description |
PROSITE profile | PS51294 | 20.918 | 75 | 125 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-15 | 75 | 123 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-14 | 76 | 121 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-25 | 78 | 126 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.48E-10 | 80 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MAPLKDETIK MEENVSPKRE VNKGAWTAEE DRKLAEVIAV HGAKRWKIIA IKAGLNRCGK 60 SCRLRWMNYL RPNIKRGNIS DQEEDLILRL HKLLGNRWSL IAGRLPGRTD NEIKNYWNSH 120 LSKKINQKEK QSGATTREGC KAQKRVVENA KEVIEENTSR GGEDSNISFD VDEFFDFSNE 180 DPLNLEWMSR FLEVDEGFN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-30 | 23 | 126 | 7 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF034131 | 1e-178 | AF034131.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017979498.1 | 1e-144 | PREDICTED: transcription factor MYB114 | ||||
Swissprot | Q96276 | 2e-54 | MYB23_ARATH; Transcription factor MYB23 | ||||
TrEMBL | A0A061GJK0 | 1e-143 | A0A061GJK0_THECC; Myb domain protein 23 | ||||
STRING | EOY27239 | 1e-144 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 1e-56 | myb domain protein 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG029126t1 |
Entrez Gene | 18596214 |
Publications ? help Back to Top | |||
---|---|---|---|
|