PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG022113t1 | ||||||||
Common Name | TCM_022113 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 83aa MW: 9052.81 Da PI: 10.4756 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 133.4 | 5.8e-42 | 17 | 82 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ++eakG+nPGlivllvv glllvflvgny+ly yaqk+lPPrkkkPvskkk+k+e+lkqGv++PGe Thecc1EG022113t1 17 ETEAKGFNPGLIVLLVVVGLLLVFLVGNYALYLYAQKSLPPRKKKPVSKKKMKKERLKQGVSAPGE 82 78***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 2.5E-40 | 18 | 82 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MSAEFEIGDK GNKISYETEA KGFNPGLIVL LVVVGLLLVF LVGNYALYLY AQKSLPPRKK 60 KPVSKKKMKK ERLKQGVSAP GE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007027283.1 | 2e-51 | PREDICTED: DNA-binding protein S1FA | ||||
Swissprot | Q7XLX6 | 2e-17 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A061ERY5 | 6e-50 | A0A061ERY5_THECC; S1FA-like DNA-binding protein | ||||
STRING | EOY07785 | 9e-51 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2823 | 27 | 69 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG022113t1 |
Entrez Gene | 18597919 |
Publications ? help Back to Top | |||
---|---|---|---|
|