PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG019107t1
Common NameTCM_019107
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family CO-like
Protein Properties Length: 383aa    MW: 42110.8 Da    PI: 5.8273
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG019107t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.73.7e-062161438
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                      r+C+++ +   + +C+ ++ +lC+ C    H        H+
  Thecc1EG019107t1 21 RVCDTCRSAACTVYCQADSAYLCAGCDARVHAAnrvasrHE 61
                      79******99*****************99995555666665 PP

2zf-B_box322.5e-1063108342
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                        ++C+ +e+ ++ + C+ +   lC +C  e+H+       H++vp+
  Thecc1EG019107t1  63 VWVCEACERAPAAFLCKADAASLCTTCDAEIHSAnplarrHQRVPI 108
                       689*****************************66899999**9997 PP

3CCT70.34.7e-24313356144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Thecc1EG019107t1 313 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 356
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.5E-91865IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3241865IPR000315B-box-type zinc finger
CDDcd000213.48E-82165No hitNo description
PROSITE profilePS5011911.47661108IPR000315B-box-type zinc finger
PfamPF006433.6E-862108IPR000315B-box-type zinc finger
CDDcd000211.12E-864108No hitNo description
SMARTSM003363.2E-1166108IPR000315B-box-type zinc finger
PfamPF062037.5E-18313355IPR010402CCT domain
PROSITE profilePS5101716.648313355IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MLKEETSDAS GGGGSGNNWA RVCDTCRSAA CTVYCQADSA YLCAGCDARV HAANRVASRH  60
ERVWVCEACE RAPAAFLCKA DAASLCTTCD AEIHSANPLA RRHQRVPILP ISGCLYGPSA  120
TELRGRKMAS AAETEDGFMD PEGDETIAED EDEAASWLLL NPGKNSTNQR NGCLFGGEVD  180
DYLDIVEYNS SVENHITDQY NQQQQHYSVP NKSYGGDSVV PIQSGEAKDH LQQQQHQQQT  240
LQFGLDYESS KAAYSYNGSV SHSVSLSSVD VGIVPESTMS DISISHRRPP KGTIDLFSGP  300
SIQMPTQLTP MDREARVLRY REKKKTRKFE KTIRYASRKA YAETRPRIKG RFAKRTDVEV  360
EVDQMFSTTL MTETGYGIVP SF*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032965.20.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-154COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A061EG800.0A0A061EG80_THECC; Zinc finger protein CONSTANS-LIKE 2
STRINGEOY038910.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-126CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  3. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]