PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG018545t1 | ||||||||
Common Name | TCM_018545 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 137aa MW: 14553.2 Da PI: 7.7384 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104.7 | 5.7e-33 | 67 | 123 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa +Gg+avDGC+Efm+s geegt+aal+CaACgCHRnFHRreve+e Thecc1EG018545t1 67 SVRYGECQKNHAAGVGGYAVDGCREFMAS-GEEGTSAALTCAACGCHRNFHRREVETE 123 69**************************9.999*********************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 1.0E-25 | 63 | 133 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.4E-30 | 68 | 120 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 5.0E-27 | 69 | 120 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.276 | 70 | 119 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MPVLNILSPI RKALSKSDNS SSALQGFGAE GGDKEEFGDR GMRKRQVVVR REEPPRSTTN 60 SSLTIRSVRY GECQKNHAAG VGGYAVDGCR EFMASGEEGT SAALTCAACG CHRNFHRREV 120 ETEVVCECSS PPSNGA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021297644.1 | 6e-83 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 3e-45 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A061EEU8 | 6e-95 | A0A061EEU8_THECC; Mini zinc finger 2 isoform 1 | ||||
STRING | EOY03457 | 1e-86 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 7e-36 | mini zinc finger 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG018545t1 |
Entrez Gene | 18601512 |
Publications ? help Back to Top | |||
---|---|---|---|
|