PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG008635t1
Common NameTCM_008635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family WRKY
Protein Properties Length: 186aa    MW: 21023.7 Da    PI: 9.9259
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG008635t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46.1e-33106164159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H h+
  Thecc1EG008635t1 106 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTRDEGIVVTTYEGMHSHP 164
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-3491164IPR003657WRKY domain
SuperFamilySSF1182909.94E-3098165IPR003657WRKY domain
PROSITE profilePS5081130.021101166IPR003657WRKY domain
SMARTSM007749.2E-39106165IPR003657WRKY domain
PfamPF031061.5E-26107164IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MENFQGFSPN SSTLSASSLS LNMTNSLGYA EFQGSKANGL LGLMAEMEVP ASLNVHNISQ  60
NKNFPEINSL AGTETETEVK LGKKKGDKKI RKPRYAFQTR SQVDILDDGY RWRKYGQKAV  120
KNNKFPRSYY RCTHQGCNVK KQVQRLTRDE GIVVTTYEGM HSHPIQKSND NFEHILSQMQ  180
IYTSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2896163774Probable WRKY transcription factor 4
2lex_A3e-2896163774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043929.11e-139PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA22e-57WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A061E4841e-137A0A061E484_THECC; WRKY DNA-binding protein 75
STRINGEOX997601e-138(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.16e-59WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Xu L, et al.
    Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis.
    Plant Cell Rep., 2012. 31(12): p. 2177-88
    [PMID:22890372]
  3. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P
    Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract.
    Plant Physiol., 2016. 170(4): p. 2432-43
    [PMID:26884488]
  6. Velasco VM, et al.
    Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes.
    Plant Cell Environ., 2016. 39(8): p. 1818-34
    [PMID:27038434]
  7. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  8. Zhang H,Huang L,Hong Y,Song F
    BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana.
    BMC Plant Biol., 2016. 16(1): p. 152
    [PMID:27389008]
  9. Zhang S, et al.
    The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling.
    Plant Physiol., 2017. 173(4): p. 2294-2307
    [PMID:28250067]
  10. Guo P, et al.
    A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence.
    Plant Cell, 2017. 29(11): p. 2854-2870
    [PMID:29061866]
  11. Zhang L,Chen L,Yu D
    Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering.
    Plant Physiol., 2018. 176(1): p. 790-803
    [PMID:29133369]