PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG008635t1 | ||||||||
Common Name | TCM_008635 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 186aa MW: 21023.7 Da PI: 9.9259 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.4 | 6.1e-33 | 106 | 164 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H h+ Thecc1EG008635t1 106 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTRDEGIVVTTYEGMHSHP 164 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.4E-34 | 91 | 164 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.94E-30 | 98 | 165 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.021 | 101 | 166 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.2E-39 | 106 | 165 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.5E-26 | 107 | 164 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0010055 | Biological Process | atrichoblast differentiation | ||||
GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MENFQGFSPN SSTLSASSLS LNMTNSLGYA EFQGSKANGL LGLMAEMEVP ASLNVHNISQ 60 NKNFPEINSL AGTETETEVK LGKKKGDKKI RKPRYAFQTR SQVDILDDGY RWRKYGQKAV 120 KNNKFPRSYY RCTHQGCNVK KQVQRLTRDE GIVVTTYEGM HSHPIQKSND NFEHILSQMQ 180 IYTSF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-28 | 96 | 163 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-28 | 96 | 163 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007043929.1 | 1e-139 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 2e-57 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A061E484 | 1e-137 | A0A061E484_THECC; WRKY DNA-binding protein 75 | ||||
STRING | EOX99760 | 1e-138 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 6e-59 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG008635t1 |
Entrez Gene | 18608942 |