PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG008462t1 | ||||||||
Common Name | TCM_008462 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 133aa MW: 14775.9 Da PI: 9.0812 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 67.1 | 4.1e-21 | 5 | 53 | 1 | 49 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal 49 +CaaCk+lrrkC +dCv++pyfp+++ ++fa +hk+FGasnv kll++ Thecc1EG008462t1 5 RCAACKYLRRKCHSDCVFSPYFPSNNLQRFASIHKIFGASNVAKLLQHN 53 6*********************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 14.33 | 4 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.1E-20 | 5 | 52 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MNPGRCAACK YLRRKCHSDC VFSPYFPSNN LQRFASIHKI FGASNVAKLL QHNVELKPVN 60 GCVGLMFLLQ QQIHNAETQL AKIRAEIAVL KSNAHHSQIQ QFEDESDSNV FLPGRHSVAH 120 PGLFNQASFG FI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-22 | 6 | 87 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-22 | 6 | 87 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021284852.1 | 3e-65 | LOB domain-containing protein 24-like | ||||
Refseq | XP_021284859.1 | 3e-65 | LOB domain-containing protein 24-like | ||||
Refseq | XP_021284866.1 | 3e-65 | LOB domain-containing protein 24-like | ||||
Refseq | XP_021284877.1 | 3e-65 | LOB domain-containing protein 24-like | ||||
Swissprot | P59467 | 2e-33 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
TrEMBL | A0A061E5V7 | 7e-93 | A0A061E5V7_THECC; LOB domain-containing protein 23, putative | ||||
STRING | EOX99696 | 1e-93 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26620.1 | 1e-35 | LOB domain-containing protein 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG008462t1 |
Entrez Gene | 18608891 |
Publications ? help Back to Top | |||
---|---|---|---|
|