PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG006625t7 | ||||||||
Common Name | TCM_006625 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 202aa MW: 22558.5 Da PI: 6.2996 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 23.8 | 9.9e-08 | 85 | 134 | 2 | 51 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 +e k +r NReA r++R++ ka+ + Le++v L a N++L k+l+ Thecc1EG006625t7 85 REKKSKKRPLGNREAVRKYREKVKARAASLEDEVVRLRALNQQLLKRLQG 134 5678889999***********************************99974 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.2E-12 | 82 | 152 | No hit | No description |
SMART | SM00338 | 6.6E-8 | 84 | 151 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 2.7E-13 | 86 | 141 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.51E-6 | 88 | 134 | No hit | No description |
CDD | cd14686 | 3.39E-10 | 90 | 143 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0071294 | Biological Process | cellular response to zinc ion | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MDDGELDFLN QEVFSGNMAD IPSSCSMDSF FDELLNDSHA CTHTHTCNPP GPDNSHTHTC 60 FHVHTKIVPA PTEDKAAIDD TAESREKKSK KRPLGNREAV RKYREKVKAR AASLEDEVVR 120 LRALNQQLLK RLQGQAALEA EIARLKCLLV DIRGRIEGEI GSFPYQKSTT NVNMMNLPGA 180 YVMNPCNVQC NDQMYCLHPG AD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ355030 | 0.0 | DQ355030.1 Gossypium hirsutum putative retinoblastoma binding protein gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007041832.2 | 1e-150 | PREDICTED: basic leucine zipper 23 | ||||
Refseq | XP_017971400.1 | 1e-150 | PREDICTED: basic leucine zipper 23 | ||||
Swissprot | Q8VY76 | 6e-98 | BZP19_ARATH; Basic leucine zipper 19 | ||||
TrEMBL | A0A061DY61 | 1e-150 | A0A061DY61_THECC; Basic-leucine zipper transcription factor family protein isoform 3 | ||||
TrEMBL | A0A061DZ79 | 1e-150 | A0A061DZ79_THECC; Basic-leucine zipper transcription factor family protein isoform 1 | ||||
TrEMBL | A0A061E612 | 1e-150 | A0A061E612_THECC; Basic-leucine zipper (BZIP) transcription factor family protein isoform 7 (Fragment) | ||||
STRING | EOX97658 | 1e-150 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35040.1 | 1e-100 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG006625t7 |
Entrez Gene | 18607547 |