PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG001465t1 | ||||||||
Common Name | TCM_001465 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 64aa MW: 7502.79 Da PI: 10.0339 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 57 | 6.5e-18 | 6 | 53 | 1 | 49 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 l+pGfrFhPtd el+++yL++kv gkk+++ e+i+e+d+yk+ PwdLp Thecc1EG001465t1 6 LAPGFRFHPTDVELLKYYLRRKVLGKKFRF-EAIAELDLYKYAPWDLPD 53 679**************************9.89**************94 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.89E-19 | 3 | 57 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 20.227 | 6 | 63 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.0E-8 | 8 | 42 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
MEKNSLAPGF RFHPTDVELL KYYLRRKVLG KKFRFEAIAE LDLYKYAPWD LPDKSLLRTG 60 DLK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-15 | 5 | 57 | 14 | 66 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017977109.1 | 3e-37 | PREDICTED: NAC domain-containing protein 82 | ||||
Swissprot | Q9FY82 | 2e-24 | NAC82_ARATH; NAC domain-containing protein 82 | ||||
TrEMBL | A0A061DJJ0 | 1e-37 | A0A061DJJ0_THECC; Transcription factor, putative | ||||
STRING | EOX92522 | 2e-38 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7967 | 13 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64060.1 | 7e-29 | NAC domain containing protein 103 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG001465t1 |
Entrez Gene | 18611846 |
Publications ? help Back to Top | |||
---|---|---|---|
|