PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_7375BED72.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ARF
Protein Properties Length: 1030aa    MW: 114843 Da    PI: 6.4495
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_7375BED72.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.32.5e-2292193199
                            EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                     B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                            f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++   W++++i+r++++r++lt+GW+ Fv+ ++L +gD+v+
  Traes_7DS_7375BED72.2  92 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELMAKDLHDIPWKFRHIFRGQPKRHLLTTGWSVFVSTKRLLAGDSVL 177
                            99*****************************96555544..8********************************************** PP

                            EEE-SSSEE..EEEEE-S CS
                     B3  82 Fkldgrsefelvvkvfrk 99 
                            F   ++++ +l+++++r+
  Traes_7DS_7375BED72.2 178 FI--RDEKSQLLLGIRRA 193
                            **..45677789999997 PP

2Auxin_resp122.92.2e-40218300183
             Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                            aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dldpvrW+nS+Wr+L+
  Traes_7DS_7375BED72.2 218 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQ 300
                            79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.49E-4382221IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.2E-4084207IPR015300DNA-binding pseudobarrel domain
CDDcd100171.36E-1891192No hitNo description
PROSITE profilePS5086311.87192194IPR003340B3 DNA binding domain
PfamPF023623.0E-2092193IPR003340B3 DNA binding domain
SMARTSM010191.8E-2192194IPR003340B3 DNA binding domain
PfamPF065073.7E-35218300IPR010525Auxin response factor
PfamPF023092.1E-99111000IPR033389AUX/IAA domain
PROSITE profilePS5174525.9389141007IPR000270PB1 domain
SuperFamilySSF542773.09E-8931993No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1030 aa     Download sequence    Send to blast
MPPVGSLVVY FPQGHSEQVA ASMHKEVDII PNYPSLPSKL ICKLLSLTLH ADSETDEVYA  60
QMTLQPVNKY DRDAMLASEL GLKQNKQPVE FFCKTLTASD TSTHGGFSVP RRAAEKIFPP  120
LDFTMQPPAQ ELMAKDLHDI PWKFRHIFRG QPKRHLLTTG WSVFVSTKRL LAGDSVLFIR  180
DEKSQLLLGI RRATRPQPAL SSSVLSSDSM HIGILAAAAH AAANSSPFTI FYNPRASPSE  240
FVIPLAKYNK ALYTQVSLGM RFRMLFETED SGVRRYMGTI TGIGDLDPVR WKNSHWRNLQ  300
VGWDESTASE RRTRVSIWEI EPVATPFYIC PPPFFRPKLP KQPGMPDDEG EVDSAFKRAM  360
PWLGDDFALK DVQSQLFPGL SLVQWMAMQQ NPQMLPAGAP AVQAPYLNSS AMAMQDGMGT  420
GNDDLMRRFN MQGQNIGLPN SQVGSKMDHP AMAQHQQQSH QLQQQQQVQQ SQQSSAVQQQ  480
QAQLLQQNAI HLQQQQEHLQ RQQSLPQQQQ EHLQRQQSQP QQQLKTAASM PSMEQHKLRE  540
QQPQGGQAVS QAQMLSQIFQ PSSSQLQQLG LPKSPTQRPG FPGLPTASSL QQPALGQAPQ  600
VQQAAEYQQA LLQSQQQQLQ QLSQPEMQLQ LLQKIQQQNM LSQLNPQHQS QLMQQLSQKN  660
QEYLQQQILQ HQLSGSDAMV QFKQSHQTPS NNITGSLTPQ QLVRSHSALA ESEDPSSSTA  720
PSASRLSPMN SLSRTHQGSR NLTDMTTSPH IDNLLQEIQS KPDNRNKNDM QSSKEAIPVP  780
NRYPVSDQLD ASSATSFCLD ESPREGFSFP PVCLDSNAQV DPRDNFLIAE NVDSLMPDAL  840
LSRGMGSGKD ICNLPSGQRD HREVDNELSS AAFSSQSFGV PDISFKPGCS GDIAVNDGGM  900
PSQGLWNNQT QRMRTFTKVQ KRGSVGRSID ITRYTNYDEL RHDLACMFGI QGQLEDPYRM  960
DWKLVYVDHE NDILLVGDDP WEEFVSCVKS IKILSSVEVQ QMSLDGDLGG IPSQTQACSA  1020
SDDANAWRGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-151132166388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3742620.0AK374262.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3058N24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020149526.10.0auxin response factor 16
RefseqXP_020160269.10.0auxin response factor 16
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLA0A3B6TLI60.0A0A3B6TLI6_WHEAT; Auxin response factor
STRINGTraes_7DS_7375BED72.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  3. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  4. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]