PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7DS_6354FF359.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 60aa MW: 7080.93 Da PI: 4.319 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 25.7 | 3.7e-08 | 25 | 60 | 1 | 36 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCs 36 +fYneYA e GFsvrks+ + n+ i+ r+ vCs Traes_7DS_6354FF359.1 25 EFYNEYALEKGFSVRKSYVEWDGSNKYIILRKIVCS 60 6**********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 6.9E-6 | 25 | 60 | IPR004330 | FAR1 DNA binding domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 60 aa Download sequence Send to blast |
ATDESMFEYL NVVSKMFDSE AEGYEFYNEY ALEKGFSVRK SYVEWDGSNK YIILRKIVCS |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 3e-88 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188780.1 | 1e-33 | protein FAR1-RELATED SEQUENCE 5-like | ||||
TrEMBL | A0A452XR33 | 2e-34 | A0A452XR33_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453DSV9 | 2e-34 | A0A453DSV9_AEGTS; Uncharacterized protein | ||||
STRING | Traes_7DS_6354FF359.1 | 3e-36 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2449 | 9 | 76 |
Publications ? help Back to Top | |||
---|---|---|---|
|