PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_2452C1E32.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 356aa    MW: 39748.2 Da    PI: 7.8436
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_2452C1E32.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.36.2e-53151422129
                    NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                            p+GfrFhPtd e+++ yL +kv +k ++   ++ evd++k+ePw+Lp+k+k +ekewyfFs++d+ky+tg r+nrat++gyWkatgkd
  Traes_7DS_2452C1E32.1  15 PQGFRFHPTDVEIITSYLVPKVLNKAFDP-IAVGEVDLNKCEPWELPEKAKMGEKEWYFFSQKDRKYPTGIRTNRATTAGYWKATGKD 101
                            89************************999.78***************99999************************************ PP

                    NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                            ke++++ +++l+g+kktLvfykgrap+g kt+Wvmheyrle
  Traes_7DS_2452C1E32.1 102 KEIFHHaTTSLIGMKKTLVFYKGRAPRGDKTNWVMHEYRLE 142
                            ****9867788****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-595177IPR003441NAC domain
PROSITE profilePS5100555.9314177IPR003441NAC domain
PfamPF023652.1E-2715141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MADHLQVQRQ QLKFPQGFRF HPTDVEIITS YLVPKVLNKA FDPIAVGEVD LNKCEPWELP  60
EKAKMGEKEW YFFSQKDRKY PTGIRTNRAT TAGYWKATGK DKEIFHHATT SLIGMKKTLV  120
FYKGRAPRGD KTNWVMHEYR LESGKQGTPS LPTDITTATA INASSKEEYV VCRIFHKSTG  180
LKKVVMSSYA IPMPMSMGAE EQHGFLESGT LPPFMGYGAS SSLVPPSSLP ASSSYQLHDA  240
GARSSMMGSA VLPMMNDHYF GNHHYQNMAT PPRPLVSFYH HDPRQQQQQQ QHMIQMPMQM  300
QIGADEGLMI GVEPGSGPSS IVSQEDTLAR LSSNDVATTA DEISSVNMGT DGMWKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-481118314171NO APICAL MERISTEM PROTEIN
1ut4_B2e-481118314171NO APICAL MERISTEM PROTEIN
1ut7_A2e-481118314171NO APICAL MERISTEM PROTEIN
1ut7_B2e-481118314171NO APICAL MERISTEM PROTEIN
3swm_A2e-481118317174NAC domain-containing protein 19
3swm_B2e-481118317174NAC domain-containing protein 19
3swm_C2e-481118317174NAC domain-containing protein 19
3swm_D2e-481118317174NAC domain-containing protein 19
3swp_A2e-481118317174NAC domain-containing protein 19
3swp_B2e-481118317174NAC domain-containing protein 19
3swp_C2e-481118317174NAC domain-containing protein 19
3swp_D2e-481118317174NAC domain-containing protein 19
4dul_A2e-481118314171NAC domain-containing protein 19
4dul_B2e-481118314171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167840.10.0protein CUP-SHAPED COTYLEDON 2-like
SwissprotQ9FLJ23e-75NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A3B6TAY40.0A0A3B6TAY4_WHEAT; Uncharacterized protein
STRINGTraes_7DS_2452C1E32.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.19e-77NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]