| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 89.9 | 1.3e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien +nrqvt+skRr gi+KKA EL vLCda+va+i+fsstgk +e++s
Traes_7DL_DDCC09B24.1 9 KRIENATNRQVTYSKRRSGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCS 59
79***********************************************96 PP
|
| 2 | K-box | 88.3 | 1.4e-29 | 71 | 168 | 1 | 98 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88
yq++ g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+ L+++eL+ Leq+++ +lk++R++K++++++q+e+ +kk k q
Traes_7DL_DDCC09B24.1 71 YQQAIGTSLWIEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDALEFEELRDLEQNVDAALKEVRQRKYHVITTQTETYKKKVKHSQ 158
67888999******************************************************************************** PP
K-box 89 eenkaLrkkl 98
e+ k+L+++l
Traes_7DL_DDCC09B24.1 159 EAYKNLQQEL 168
*******987 PP
|
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Chen ZX, et al.
Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice.
Planta, 2006. 223(5): p. 882-90
[PMID:16254725] - Zhang Q, et al.
Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull.
J Genet Genomics, 2007. 34(6): p. 519-26
[PMID:17601611] - Yoshida H, et al.
superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice.
Plant Biotechnol. J., 2007. 5(6): p. 835-46
[PMID:17764519] - Paolacci AR,Tanzarella OA,Porceddu E,Varotto S,Ciaffi M
Molecular and phylogenetic analysis of MADS-box genes of MIKC type and chromosome location of SEP-like genes in wheat (Triticum aestivum L.).
Mol. Genet. Genomics, 2007. 278(6): p. 689-708
[PMID:17846794] - Yao SG,Ohmori S,Kimizu M,Yoshida H
Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development.
Plant Cell Physiol., 2008. 49(5): p. 853-7
[PMID:18378529] - Xiao H, et al.
STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice.
Plant J., 2009. 59(5): p. 789-801
[PMID:19453444] - Seok HY, et al.
Rice ternary MADS protein complexes containing class B MADS heterodimer.
Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
[PMID:20888318] - Li H, et al.
Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
Plant Cell, 2011. 23(7): p. 2536-52
[PMID:21784949] - Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T
Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58.
Plant Sci., 2012. 183: p. 183-9
[PMID:22195592] - Ohmori S,Tabuchi H,Yatou O,Yoshida H
Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation.
Breed. Sci., 2012. 62(2): p. 124-32
[PMID:23136523] - Brenchley R, et al.
Analysis of the bread wheat genome using whole-genome shotgun sequencing.
Nature, 2012. 491(7426): p. 705-10
[PMID:23192148] - Yun D, et al.
OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice.
Mol Plant, 2013. 6(3): p. 743-56
[PMID:23300256] - Lombardo F, et al.
The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice.
Plant Biotechnol. J., 2017. 15(1): p. 97-106
[PMID:27336225]
|
