PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_7DL_15FC3C682.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

M-type_MADS

Protein Properties

Length: 78aa MW: 8389.74 Da PI: 11.1789

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_7DL_15FC3C682.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	62.4	5.2e-20	10	57	2	49
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 r+e k rqvtfskR+ g+ KKA EL vLC a a+++fs+ gk + + Traes_7DL_15FC3C682.1 10 RVEKKESRQVTFSKRKSGLWKKAAELAVLCRASLAIVVFSEAGKAFAF 57 78999**************************************98776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	24.151	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	6.1E-24	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	6.41E-23	2	68	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-19	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.7E-22	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-19	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-19	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
KGRQRRENRR VEKKESRQVT FSKRKSGLWK KAAELAVLCR ASLAIVVFSE AGKAFAFGSP 60 STDAVLGCAD ALAPVPAA

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020191502.1	1e-47	agamous-like MADS-box protein AGL61
Swissprot	O64703	4e-18	AGL29_ARATH; Agamous-like MADS-box protein AGL29
Swissprot	Q9FKK2	1e-17	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A3B6SIN5	1e-46	A0A3B6SIN5_WHEAT; Uncharacterized protein
STRING	Traes_7DL_15FC3C682.1	3e-48	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G34440.1	2e-20	AGAMOUS-like 29

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]