PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7BL_E2E7AA383.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 125aa MW: 14314.2 Da PI: 4.8666 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 29.7 | 1.1e-09 | 57 | 104 | 6 | 53 |
S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS Homeobox 6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 +++k qle+Le+++ k++ p+ +++ + + ++L+ + + WF rR Traes_7BL_E2E7AA383.1 57 RLKKAQLETLEKVYFKSKRPTNTMISSIVQVTSLPRKTIIKWFEDRRE 104 6789******************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 9.556 | 49 | 109 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.13E-10 | 52 | 106 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 6.93E-8 | 52 | 103 | No hit | No description |
SMART | SM00389 | 6.6E-4 | 55 | 113 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 9.6E-9 | 56 | 105 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 2.9E-7 | 57 | 104 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MSDSLPDEAP SKPETKEIET SPVADEVEVD EIEATETKPQ MDLPVHVMST EWSAQKRLKK 60 AQLETLEKVY FKSKRPTNTM ISSIVQVTSL PRKTIIKWFE DRREQDGVPD RRAAYMRSLS 120 ETMAS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid (JA)-mediated COI1-dependent and abscisic acid (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. B.cinerea and P.cucumerina) and bacterial pathogens (e.g. P.syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the P.fluorescens WCS417r-triggered JA-dependent induced systemic resistance (ISR) against both P.syringae DC3000 and H.arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769). {ECO:0000250|UniProtKB:Q70Z19, ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769, ECO:0000269|PubMed:20836879, ECO:0000269|PubMed:21564353}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Constitutively expressed in healthy plants but repressed in response to infection by necrotrophic fungi (PubMed:15923348). Repressed by drought and abscisic acid (ABA) (PubMed:19175769). {ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK362732 | 1e-178 | AK362732.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2009L22. | |||
GenBank | AK374231 | 1e-178 | AK374231.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3058E17. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020156983.1 | 6e-82 | protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3 | ||||
Swissprot | Q8H0V5 | 1e-34 | OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3 | ||||
TrEMBL | A0A3B6SFJ3 | 5e-81 | A0A3B6SFJ3_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A453S9R2 | 1e-81 | A0A453S9R2_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453SA07 | 4e-81 | A0A453SA07_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453SAQ1 | 2e-81 | A0A453SAQ1_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453SAQ3 | 2e-81 | A0A453SAQ3_AEGTS; Uncharacterized protein | ||||
STRING | Traes_7BL_E2E7AA383.1 | 3e-85 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10700 | 35 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11270.1 | 5e-36 | overexpressor of cationic peroxidase 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|