PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7BL_8A5D12EE1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 128aa MW: 14868.5 Da PI: 6.9747 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 107.4 | 1.7e-33 | 43 | 127 | 2 | 87 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 +pGfrFhPt+eel+ +yL++kv+gk++++ + i++vd+y+++PwdLp+ ++ ++kew+f+++rd+ky++g+r+nr+t sgyWkatg Traes_7BL_8A5D12EE1.1 43 MPGFRFHPTEEELIEFYLRRKVDGKRFNI-DLIASVDLYRYDPWDLPALASIGDKEWFFYVPRDRKYRNGDRPNRVTPSGYWKATG 127 79***************************.99***************888889********************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.02E-36 | 41 | 127 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 36.575 | 42 | 128 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.5E-15 | 44 | 126 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MTRSRPTTTT TMGGSVPDHH HHQHDGEVDG GQLQHGEHVE TVMPGFRFHP TEEELIEFYL 60 RRKVDGKRFN IDLIASVDLY RYDPWDLPAL ASIGDKEWFF YVPRDRKYRN GDRPNRVTPS 120 GYWKATGA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-35 | 44 | 128 | 17 | 101 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY672069 | 1e-158 | AY672069.1 Hordeum vulgare subsp. vulgare NAC transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020156931.1 | 8e-85 | NAC domain-containing protein 35-like | ||||
Swissprot | Q9ZVP8 | 7e-54 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A3B6SM43 | 1e-90 | A0A3B6SM43_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446YIT5 | 1e-90 | A0A446YIT5_TRITD; Uncharacterized protein | ||||
STRING | Traes_7BL_8A5D12EE1.1 | 2e-91 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7706 | 36 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.1 | 2e-54 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|