PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7AS_6A126F5F5.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 114aa MW: 13299.2 Da PI: 10.2722 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41 | 4.5e-13 | 57 | 103 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r+ WT+eE++ ++ + + +G g+Wk I++++ +++t+ q+ s+ qk+ Traes_7AS_6A126F5F5.1 57 RKYWTKEEHKSFLYGLEVYGRGDWKNISKHFITTKTPVQVSSHAQKF 103 678******************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 5.25E-17 | 55 | 109 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 12.167 | 55 | 108 | IPR017884 | SANT domain |
Gene3D | G3DSA:1.10.10.60 | 6.3E-11 | 56 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-10 | 56 | 106 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 3.1E-14 | 56 | 106 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 7.6E-10 | 57 | 102 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.79E-9 | 60 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MIDNGFSFRC ALEDTTQLED TRIRKMEEAP MMVDKNKMVV LENKTSTDRP VVAAHQRKYW 60 TKEEHKSFLY GLEVYGRGDW KNISKHFITT KTPVQVSSHA QKFFKRIQKK GSSG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020167095.1 | 2e-73 | uncharacterized protein LOC109752608 | ||||
Swissprot | Q8S9H7 | 3e-17 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A3B6TAG6 | 4e-72 | A0A3B6TAG6_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A453QWE6 | 5e-72 | A0A453QWE6_AEGTS; Uncharacterized protein | ||||
STRING | Traes_7AS_6A126F5F5.1 | 9e-82 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP842 | 30 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38090.1 | 2e-20 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|