PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7AL_AF1593775.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 148aa MW: 17012.6 Da PI: 8.4867 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 23.4 | 1e-07 | 1 | 38 | 16 | 55 |
HHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 16 iNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 +N+ +++Lr+l+P+a + kKls +++ ++ +YI +Lq Traes_7AL_AF1593775.1 1 LNQLYSTLRSLIPNA--DHTKKLSIPTTVCQVLDYIPELQ 38 69************7..35666***************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00083 | 2.90E-5 | 1 | 42 | No hit | No description |
SuperFamily | SSF47459 | 7.07E-9 | 1 | 53 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
PROSITE profile | PS50888 | 9.585 | 1 | 37 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 8.2E-5 | 1 | 38 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 7.9E-7 | 1 | 53 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
LNQLYSTLRS LIPNADHTKK LSIPTTVCQV LDYIPELQKQ VEDLEKKKQE LTRAKCRERL 60 QRVKDNTGRI VSATPLDGNE IMVQVSLLSN MAASLPLSKC INVFENEGLH LISSSTFSTE 120 VNRTFYSFHF EVHFYMRPSF PVHTVLTW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the DNA motif 5'-CACGTGG-3' in the promoter of iron (Fe) deficiency-inducible genes as well as of genes involved in iron homeostasis, thus contributing to basal tolerance to iron deficiency, iron uptake from soil and iron transport, particularly during seed maturation and germination. Promotes the accumulation of mugineic acid family phytosiderophores (MAs). Required for ethylene-mediated signaling during iron deficiency responses. Improves growth and yield, especially in calcareous soil with low iron availability. Promotes iron concentration in shoots and grain. {ECO:0000250|UniProtKB:Q0JFZ0}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020165798.1 | 8e-89 | transcription factor ORG2-like | ||||
Swissprot | A2WZ60 | 3e-49 | IRO2_ORYSI; Protein IRON-RELATED TRANSCRIPTION FACTOR 2 | ||||
TrEMBL | M8AKX9 | 6e-91 | M8AKX9_TRIUA; Transcription factor ORG2 | ||||
STRING | Traes_7AL_AF1593775.1 | 1e-107 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3280 | 34 | 72 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56970.1 | 1e-22 | bHLH family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|