PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_38B48B7B2.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 362aa    MW: 40600.6 Da    PI: 8.0894
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_38B48B7B2.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.11.2e-51331601129
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdee++++y  +kv ++ + +  +i++v+++k+ePw+Lp+k+k +ekewyf++++d+ky+tg r+n+a ++gyWkatgk
  Traes_7AL_38B48B7B2.2  33 LPPGFRFHPTDEEIIKFYVVPKVLDEAFVA-AAIEDVNLNKYEPWELPEKAKMGEKEWYFYCRKDRKYPTGIRTNQAKNAGYWKATGK 119
                            79*************************998.78***************99999*********************************** PP

                    NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                            dke+++   +l+g+kktLvfykgrap+gekt+W+mheyrle
  Traes_7AL_38B48B7B2.2 120 DKEIFHPPLTLIGMKKTLVFYKGRAPRGEKTNWIMHEYRLE 160
                            ***************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-5920195IPR003441NAC domain
PROSITE profilePS5100555.85833195IPR003441NAC domain
PfamPF023654.5E-2634159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MIASNIAITL ESIAEKASTM TDHLQVQQQK LELPPGFRFH PTDEEIIKFY VVPKVLDEAF  60
VAAAIEDVNL NKYEPWELPE KAKMGEKEWY FYCRKDRKYP TGIRTNQAKN AGYWKATGKD  120
KEIFHPPLTL IGMKKTLVFY KGRAPRGEKT NWIMHEYRLE SNKQLTSNPS TATRTVTITN  180
ASSKEQWVVC RIFHKSAGLK KVVMPSYVMP MSIGAEHQQG FADLDTLPPL MGYEMSSSLA  240
NPMLLPTTSP YQLRDIGAGS SIMGSMALPI MNDHYIGNHH QQMMSDPTPP LSFYQQHQQM  300
MMYVGADRGF MVGAEPGCGP SSMVSQEHAV TGLSNNYQGN AAATAVGKTS SMNMGMDDMW  360
KY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-48232013171NO APICAL MERISTEM PROTEIN
1ut4_B1e-48232013171NO APICAL MERISTEM PROTEIN
1ut7_A1e-48232013171NO APICAL MERISTEM PROTEIN
1ut7_B1e-48232013171NO APICAL MERISTEM PROTEIN
4dul_A1e-48232013171NAC domain-containing protein 19
4dul_B1e-48232013171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197613e-43FR819761.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC009 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190152.10.0NAC domain-containing protein 79-like
RefseqXP_020197199.10.0NAC domain-containing protein 79-like
SwissprotQ9FLJ26e-77NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A3B6RPW90.0A0A3B6RPW9_WHEAT; Uncharacterized protein
STRINGTraes_7AL_38B48B7B2.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.13e-79NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]