PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_6DS_90A627C3F.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 177aa MW: 19742.5 Da PI: 10.2836 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171 | 3.7e-53 | 36 | 168 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+ Traes_6DS_90A627C3F.1 36 LPPGFRFHPTDEELVVHYLKKKAAKVPLPV-TIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGT 122 79****************************.89***************988899********************************** PP NAM 89 dkevlsk......kgelvglkktLvfykgrapkgektdWvmheyrl 128 dk++l++ +e+ g+kk Lvfy+g+ pkg kt+W+mheyrl Traes_6DS_90A627C3F.1 123 DKPILASgtgcglVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRL 168 ******98777776677***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.29E-59 | 33 | 172 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.678 | 36 | 177 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.6E-28 | 37 | 168 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MRSMGSSDSS SGSAQKAARH QHEPPPPRQR GSAPELPPGF RFHPTDEELV VHYLKKKAAK 60 VPLPVTIIAE VDLYKFDPWE LPEKATFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT 120 GTDKPILASG TGCGLVREKL GVKKALVFYR GKPPKGLKTN WIMHEYRLTD ASGSTTT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-66 | 28 | 168 | 5 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-B2) and one extra pseudogene (NAM-B1) (PubMed:17124321). {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM820889 | 0.0 | KM820889.1 Triticum aestivum cultivar Chinese Spring NAC transcription factor NAM-D1 (NAM-D1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020187501.1 | 1e-128 | NAC transcription factor NAM-A1 | ||||
Swissprot | A0SPJ3 | 1e-126 | NAMA1_TRITD; NAC transcription factor NAM-A1 | ||||
TrEMBL | A0A3B6QB09 | 1e-127 | A0A3B6QB09_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A453N953 | 1e-127 | A0A453N953_AEGTS; Uncharacterized protein | ||||
STRING | Traes_6AS_6F89CC969.1 | 1e-127 | (Triticum aestivum) | ||||
STRING | Traes_6DS_90A627C3F.1 | 1e-129 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7572 | 36 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 2e-82 | NAC domain containing protein 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|