PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_6DL_3F9FA4887.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bHLH

Protein Properties

Length: 88aa MW: 9884.1 Da PI: 8.5247

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_6DL_3F9FA4887.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	22.7	1.8e-07	15	54	15	54
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 ++N+ +++L++llP++ + +s s L++++ YIksL Traes_6DL_3F9FA4887.1 15 EVNELMSKLQSLLPNSRRRGSSQASTTKLLKETCSYIKSL 54 68***********77899999**************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	9.724	1	54	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	1.44E-9	14	77	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	1.1E-4	15	54	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	1.2E-8	15	74	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0080113	Biological Process	regulation of seed growth
GO:0005634	Cellular Component	nucleus
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MSSRRSSRGA ISDEEVNELM SKLQSLLPNS RRRGSSQAST TKLLKETCSY IKSLHREVDD 60 LSDRLSDLMS TMDHNSAEAE IIRGILRS

Functional Description ? help Back to Top
Source	Description
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea (By similarity). {ECO:0000250}.
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. {ECO:0000269\|PubMed:23136524}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK375631	1e-131	AK375631.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3099P09.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020172556.1	1e-55	transcription factor ILI5
Swissprot	A2X9L8	4e-43	ILI5_ORYSI; Transcription factor ILI5
Swissprot	Q6YUX0	4e-43	ILI5_ORYSJ; Transcription factor ILI5
TrEMBL	A0A3B6QL09	2e-54	A0A3B6QL09_WHEAT; Uncharacterized protein
TrEMBL	A0A453PK21	2e-54	A0A453PK21_AEGTS; Uncharacterized protein
STRING	Traes_6DL_3F9FA4887.1	4e-55	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP928	38	145

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26945.1	8e-19	bHLH family protein

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]