PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_6DL_2CD01D459.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 219aa MW: 24414.6 Da PI: 10.623 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.2 | 6.6e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd lv +kq+G tW++ ++ g+ R++k+c++rw +yl Traes_6DL_2CD01D459.1 14 RGPWTAEEDMTLVAHIKQHGHSTWRALPKQAGLLRCGKSCRLRWINYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 48 | 2.9e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T eE++ ++++ ++lG++ W+tIa++++ gRt++++k+ w+++l Traes_6DL_2CD01D459.1 67 RGNFTSEEEDAIIQLDAMLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.8E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 13.491 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.54E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.7E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.4E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.10E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 23.936 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.4E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.2E-12 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-13 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.42E-9 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MGRSPCCEKT GIKRGPWTAE EDMTLVAHIK QHGHSTWRAL PKQAGLLRCG KSCRLRWINY 60 LRPDIKRGNF TSEEEDAIIQ LDAMLGNRWS TIAARLPGRT DNEIKNVWHT HLKKRLDSSS 120 SKTSGQASPK RKAEKPAVAA STLEDPTSDP VSPEQSLSTS SATDYSMASS LNTGSLGRVP 180 DRRQLLVGDT CDVGGQLRFR DGNQRHLRRR SRIAVVEQR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-26 | 14 | 118 | 7 | 110 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of cold tolerance. Negatively regulates beta-amylase genes at the transcriptional level in response to cold stress. Suppresses beta-amylase gene expression by interacting with TIFY11A/JAZ9. Maltose produced by beta-amylases has a role in protecting cell membranes under cold stress conditions in rice and may contribute to the cold tolerance as a compatible solute. {ECO:0000269|PubMed:28062835}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by cold stress and flooding. {ECO:0000269|PubMed:28062835}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GU011687 | 0.0 | GU011687.1 Leymus multicaulis MYB1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020182109.1 | 1e-113 | myb-related protein Myb4-like | ||||
Swissprot | Q6K1S6 | 9e-79 | MYB30_ORYSJ; Transcription factor MYB30 | ||||
TrEMBL | A0A3B6QF76 | 1e-160 | A0A3B6QF76_WHEAT; Uncharacterized protein | ||||
STRING | Traes_6DL_2CD01D459.1 | 1e-161 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 9e-74 | myb domain protein 15 |
Publications ? help Back to Top | |||
---|---|---|---|
|