PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_6BS_B2C9F123A.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 146aa MW: 16635.1 Da PI: 10.2793 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.9 | 8.6e-17 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl Traes_6BS_B2C9F123A.1 15 KGLWSPEEDQRLRDYILKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 62 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.5 | 1.1e-16 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg +++eE++ +++ ++lG++ W+ Ia +++ gRt++++k++w++yl Traes_6BS_B2C9F123A.1 68 RGMFSQEEEDVVINLQAKLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 113 789*******************.*********.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.46 | 10 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.17E-29 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-11 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.5E-15 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-22 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.07E-10 | 18 | 62 | No hit | No description |
PROSITE profile | PS51294 | 25.295 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-14 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.2E-15 | 68 | 113 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-25 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.21E-11 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MGCRSCDKPK MNYRKGLWSP EEDQRLRDYI LKHGLGCWSA VPAKAGLQRN GKSCRLRWIN 60 YLRPGLKRGM FSQEEEDVVI NLQAKLGNKW SQIAMHLPGR TDNEVKNYWN SYLKKRVMQL 120 GSNSSSNPAS KNASPELLTS MSATTE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-27 | 9 | 117 | 23 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK368664 | 0.0 | AK368664.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077L03. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020177025.1 | 1e-106 | transcription factor MYB6-like | ||||
Swissprot | Q8LPH6 | 3e-53 | MYB86_ARATH; Transcription factor MYB86 | ||||
Swissprot | Q9M0K4 | 2e-53 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | A0A3B6NK95 | 1e-105 | A0A3B6NK95_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6PE26 | 1e-105 | A0A3B6PE26_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6QBF8 | 1e-105 | A0A3B6QBF8_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446VZG9 | 1e-105 | A0A446VZG9_TRITD; Uncharacterized protein | ||||
TrEMBL | M7ZK35 | 1e-105 | M7ZK35_TRIUA; Transcription factor MYB86 | ||||
STRING | Traes_6AS_7C1FD879C.1 | 1e-105 | (Triticum aestivum) | ||||
STRING | Traes_6DS_8F05AE571.2 | 1e-106 | (Triticum aestivum) | ||||
STRING | TRIUR3_11495-P1 | 1e-106 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1707 | 37 | 109 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G25560.1 | 2e-55 | myb domain protein 18 |
Publications ? help Back to Top | |||
---|---|---|---|
|