PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_6BS_444F0E79E.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 165aa MW: 18750.8 Da PI: 10.3031 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 51.2 | 2.7e-16 | 23 | 52 | 26 | 55 |
G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 +AtPkti+++m+vkgLtl+h+kSHLQk+Rl Traes_6BS_444F0E79E.1 23 EATPKTIMRVMGVKGLTLYHLKSHLQKFRL 52 69***************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
TIGRFAMs | TIGR01557 | 5.5E-10 | 23 | 53 | IPR006447 | Myb domain, plants |
SuperFamily | SSF46689 | 9.85E-6 | 23 | 53 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.9E-14 | 23 | 53 | IPR009057 | Homeodomain-like |
Pfam | PF14379 | 2.0E-20 | 94 | 149 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MYSVLVICFI INSIAENFVF VVEATPKTIM RVMGVKGLTL YHLKSHLQKF RLGKQPHKDF 60 NDHAVKDAAA AMEMHRNAAS SSGIMGRNLN DRNVHMNEAI RMQMEVQRRL HEQLEVINQP 120 RIKVQKHLQM RIEAQGKYMQ SILEKAYQTL ATGDVAASPT AGYKS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK357363 | 0.0 | AK357363.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1051J01. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020150563.1 | 4e-98 | myb family transcription factor APL-like isoform X1 | ||||
Swissprot | Q9SAK5 | 7e-53 | APL_ARATH; Myb family transcription factor APL | ||||
TrEMBL | A0A287TSQ5 | 1e-107 | A0A287TSQ5_HORVV; Uncharacterized protein | ||||
STRING | Traes_6BS_444F0E79E.1 | 1e-121 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2504 | 38 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79430.2 | 2e-48 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|