PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5DS_446974FE9.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 111aa MW: 12898.9 Da PI: 10.4443 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 110.9 | 1.4e-34 | 21 | 98 | 51 | 129 |
NAM 51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 ++ + kewyf+s +d+kyatg+r+nrat sgyWkatgkd+ v + +g+lvg++ktLvfy+grapkg+kt+Wvmheyrle Traes_5DS_446974FE9.2 21 ASVGGKEWYFYSLKDRKYATGQRTNRATVSGYWKATGKDRVVAR-RGALVGMRKTLVFYQGRAPKGRKTEWVMHEYRLE 98 445789**********************************9999.999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 36.359 | 1 | 111 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.4E-16 | 16 | 97 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 2.62E-34 | 22 | 102 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
LYLSLPCWYL YIIFHFLSVT ASVGGKEWYF YSLKDRKYAT GQRTNRATVS GYWKATGKDR 60 VVARRGALVG MRKTLVFYQG RAPKGRKTEW VMHEYRLEGA HEQASKVISC H |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 6e-30 | 17 | 97 | 62 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-30 | 17 | 97 | 62 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-30 | 17 | 97 | 62 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-30 | 17 | 97 | 62 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
3swm_B | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
3swm_C | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
3swm_D | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
3swp_A | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
3swp_B | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
3swp_C | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
3swp_D | 6e-30 | 17 | 97 | 65 | 145 | NAC domain-containing protein 19 |
4dul_A | 6e-30 | 17 | 97 | 62 | 142 | NAC domain-containing protein 19 |
4dul_B | 6e-30 | 17 | 97 | 62 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC771286 | 1e-146 | KC771286.1 Triticum aestivum cultivar Suwon11 NAC transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020198650.1 | 3e-58 | NAC domain-containing protein 21/22-like isoform X1 | ||||
Refseq | XP_020198651.1 | 3e-58 | NAC domain-containing protein 21/22-like isoform X2 | ||||
Swissprot | Q84TE6 | 4e-44 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | A0A088AX64 | 9e-62 | A0A088AX64_WHEAT; NAC transcription factor 6C | ||||
TrEMBL | A0A446TVD9 | 9e-62 | A0A446TVD9_TRITD; Uncharacterized protein | ||||
STRING | Traes_5DS_446974FE9.2 | 1e-77 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP27555 | 3 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56010.1 | 5e-47 | NAC domain containing protein 1 |