PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5BL_F258582BB.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 167aa MW: 17869.5 Da PI: 10.8033 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 61.4 | 1.1e-19 | 27 | 61 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+ttkTplWR gp+g+ +LCnaCG++yrkk++ Traes_5BL_F258582BB.1 27 CTACNTTKTPLWRGGPSGPMSLCNACGIRYRKKRR 61 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 2.52E-14 | 20 | 60 | No hit | No description |
SMART | SM00401 | 3.5E-15 | 21 | 74 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.585 | 21 | 57 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.0E-15 | 22 | 61 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 5.96E-14 | 26 | 74 | No hit | No description |
Pfam | PF00320 | 2.4E-17 | 27 | 61 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MSSSVEKGSG SLDPGERPAA GSQPKACTAC NTTKTPLWRG GPSGPMSLCN ACGIRYRKKR 60 REAMGLEDPP KKRQPAAAAA PAAAAVACSE AGGESADPEQ QQQPPQQQPK KKTTTTKRGR 120 EVELRVVGFG KEVVLKQRRR MRRRPRLGEE EKAAILLMAL SSGVIYG |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 136 | 142 | QRRRMRR |
2 | 138 | 143 | RRMRRR |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00335 | DAP | Transfer from AT3G06740 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK370909 | 0.0 | AK370909.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2120C01. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020169086.1 | 2e-78 | GATA transcription factor 15-like | ||||
TrEMBL | A0A3B6LX43 | 1e-115 | A0A3B6LX43_WHEAT; Uncharacterized protein | ||||
STRING | Traes_5BL_F258582BB.1 | 1e-116 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06740.1 | 6e-22 | GATA transcription factor 15 |
Publications ? help Back to Top | |||
---|---|---|---|
|