PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_5BL_68FFE0FFA.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 65aa MW: 7499.81 Da PI: 10.8371

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5BL_68FFE0FFA.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.8	8e-16	19	64	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l Traes_5BL_68FFE0FFA.1 19 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 64 78***************************.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	21.103	13	65	IPR017930	Myb domain
SuperFamily	SSF46689	4.24E-14	14	64	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.0E-16	16	65	IPR009057	Homeodomain-like
SMART	SM00717	3.9E-10	17	65	IPR001005	SANT/Myb domain
Pfam	PF00249	9.4E-14	19	64	IPR001005	SANT/Myb domain
CDD	cd00167	1.41E-11	21	64	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
EAQRGSKGAG KMRIMIKGGV WKNTEDEILK AAVMKYGKNQ WARISSLLVR KSAKQCKARW 60 YEWLD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
5xjc_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
5yzg_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
5z56_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
5z57_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
5z58_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
6ff4_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
6ff7_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
6icz_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
6id0_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
6id1_L	2e-27	13	65	3	55	Cell division cycle 5-like protein
6qdv_O	2e-27	13	65	3	55	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP012612	5e-72	CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBank	CR855091	5e-72	CR855091.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0130K07, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002507152.1	4e-32	predicted protein, partial
Refseq	XP_003056512.1	6e-32	predicted protein, partial
Refseq	XP_016516169.1	3e-32	PREDICTED: cell division cycle 5-like protein, partial
Refseq	XP_019232628.1	8e-32	PREDICTED: cell division cycle 5-like protein
Refseq	XP_020687555.1	9e-32	cell division cycle 5-like protein isoform X1
Swissprot	P92948	3e-32	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A498IGI2	2e-31	A0A498IGI2_MALDO; Uncharacterized protein
STRING	Traes_5BL_68FFE0FFA.1	2e-39	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP25524	3	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	1e-34	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]