PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_581C3F5DA.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 217aa    MW: 25195.2 Da    PI: 6.759
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_581C3F5DA.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1761.1e-5461331128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            lppGfrFhPtdeelv++yLk+kv+g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+t
  Traes_5BL_581C3F5DA.1   6 LPPGFRFHPTDEELVNYYLKRKVHGQSIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGCRTNRATRAGYWKST 92 
                            79****************************.99**************84335556888****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd+++   +++ +g+kktLvfy+grap+g +++Wvmheyr+
  Traes_5BL_581C3F5DA.1  93 GKDRSINY-QKRSIGMKKTLVFYQGRAPQGIRSNWVMHEYRI 133
                            *******9.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-644157IPR003441NAC domain
PROSITE profilePS5100559.7656156IPR003441NAC domain
PfamPF023651.3E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKVHG QSIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRSINY QKRSIGMKKT LVFYQGRAPQ  120
GIRSNWVMHE YRIEESECNN TMGVQDSYAL CRVFKKNVPA GEFEKQGECS SSQAKGNQEQ  180
VTEFEDAGES STANENDKDN SWMQFIVEDL WCSNKTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-56215611168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1375961e-69AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence.
GenBankAP0055641e-69AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence.
GenBankAP0149651e-69AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126171e-69CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020186594.11e-163NAC domain-containing protein 86-like
SwissprotQ9FFI53e-86NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A3B6LS201e-163A0A3B6LS20_WHEAT; Uncharacterized protein
TrEMBLA0A446UJG31e-163A0A446UJG3_TRITD; Uncharacterized protein
STRINGTraes_5BL_581C3F5DA.11e-164(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-111NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]