PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_2131D2B17.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 381aa    MW: 42970.5 Da    PI: 6.931
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_2131D2B17.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.77.9e-52171432128
                    NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                            +pGfrFhPtdeelv++yLkkk+++k++++ e i+++diyk++PwdLpk ++++e++wyf+++rd+ky+++ r+nr+t++g+Wkatg+d
  Traes_5BL_2131D2B17.1  17 MPGFRFHPTDEELVSFYLKKKIQQKPISI-ELIRQLDIYKFDPWDLPKLASTGETDWYFYCPRDRKYRNSARPNRVTAAGFWKATGTD 103
                            69***************************.89***************88888999********************************* PP

                    NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            ++++s+ +++ +glkk+Lvfy+gra +g ktdW+mhe+rl
  Traes_5BL_2131D2B17.1 104 RPIYSSeGTRCIGLKKSLVFYRGRAARGIKTDWMMHEFRL 143
                            *****856667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.216174IPR003441NAC domain
SuperFamilySSF1019411.44E-5616174IPR003441NAC domain
PfamPF023651.1E-2518143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEGINDVNMD KSDEIIMPGF RFHPTDEELV SFYLKKKIQQ KPISIELIRQ LDIYKFDPWD  60
LPKLASTGET DWYFYCPRDR KYRNSARPNR VTAAGFWKAT GTDRPIYSSE GTRCIGLKKS  120
LVFYRGRAAR GIKTDWMMHE FRLPSLTDPS LPKRPIDKNI PLNDSWTICK IFKKTSSMAQ  180
QMALSHTWGP PLPGTTEQDL FSAMQPVQAS HFASESSSRS LHVAEAPASQ FNSKHGFQGQ  240
QQLQKPSNTQ DGSSCKVISF NCNPSLELEG PTILPFQTQP SQKPEHTAPP LFNMQFGQPE  300
QQITGFLADS SADVNAGMSC RNQESSTMKH GNTFSMNNEL EAPGKLTFPF DLGADSSDDW  360
KCNMPWESFL SPTVPAEMPQ Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-511817719168NO APICAL MERISTEM PROTEIN
1ut4_B1e-511817719168NO APICAL MERISTEM PROTEIN
1ut7_A1e-511817719168NO APICAL MERISTEM PROTEIN
1ut7_B1e-511817719168NO APICAL MERISTEM PROTEIN
3swm_A1e-511817722171NAC domain-containing protein 19
3swm_B1e-511817722171NAC domain-containing protein 19
3swm_C1e-511817722171NAC domain-containing protein 19
3swm_D1e-511817722171NAC domain-containing protein 19
3swp_A1e-511817722171NAC domain-containing protein 19
3swp_B1e-511817722171NAC domain-containing protein 19
3swp_C1e-511817722171NAC domain-containing protein 19
3swp_D1e-511817722171NAC domain-containing protein 19
4dul_A1e-511817719168NAC domain-containing protein 19
4dul_B1e-511817719168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020199016.10.0protein FEZ-like
SwissprotQ9ZVH01e-94FEZ_ARATH; Protein FEZ
TrEMBLA0A3B6LRR90.0A0A3B6LRR9_WHEAT; Uncharacterized protein
STRINGTraes_5BL_2131D2B17.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.13e-95NAC domain containing protein 94
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]