PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_5AS_E1F692526.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 173aa MW: 18419.3 Da PI: 4.3598

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5AS_E1F692526.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	41.9	2.3e-13	40	79	3	44
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +WT eE +ll+++ +++ + W++Ia+++g +++ qc++++ Traes_5AS_E1F692526.1 40 SWTHEETLLLLEGLEKYNDN-WNAIAEHVG-TKSKAQCIHHF 79 7**************977.*****.********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51293	20.832	36	87	IPR017884	SANT domain
SMART	SM00717	1.1E-11	37	85	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.51E-13	38	90	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.3E-8	39	79	IPR009057	Homeodomain-like
Pfam	PF00249	2.8E-13	40	79	IPR001005	SANT/Myb domain
CDD	cd00167	1.21E-4	58	79	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 173 aa Download sequence Send to blast
ADIALCLDCF HDARFVPGHS SLDFERVDGT KDGSDNDGDS WTHEETLLLL EGLEKYNDNW 60 NAIAEHVGTK SKAQCIHHFI CIPVEDGLLE SIEVPEASVS SRVQSNGFSY SNSNGGISGS 120 VPQSSQPGQQ LPFVNSANPV MSLVAFLASA VGPRIAASCA NAALSVLTRD DSR

Functional Description ? help Back to Top
Source	Description
UniProt	Component of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors. {ECO:0000269\|PubMed:14682613, ECO:0000269\|PubMed:16055636}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK362277	0.0	AK362277.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2003O22.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020193019.1	1e-116	SWI/SNF complex subunit SWI3C-like
Swissprot	Q9XI07	5e-60	SWI3C_ARATH; SWI/SNF complex subunit SWI3C
TrEMBL	A0A3B6KFQ4	1e-118	A0A3B6KFQ4_WHEAT; Uncharacterized protein
TrEMBL	A0A446SV78	1e-118	A0A446SV78_TRITD; Uncharacterized protein
TrEMBL	A0A446SVA7	1e-119	A0A446SVA7_TRITD; Uncharacterized protein
TrEMBL	A0A453K859	1e-121	A0A453K859_AEGTS; Uncharacterized protein
STRING	Traes_5AS_E1F692526.1	1e-125	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2692	4	7

Publications ? help Back to Top
Sarnowski TJ,Swiezewski S,Pawlikowska K,Kaczanowski S,Jerzmanowski A AtSWI3B, an Arabidopsis homolog of SWI3, a core subunit of yeast Swi/Snf chromatin remodeling complex, interacts with FCA, a regulator of flowering time. Nucleic Acids Res., 2002. 30(15): p. 3412-21 [PMID:12140326] Zhou C,Miki B,Wu K CHB2, a member of the SWI3 gene family, is a global regulator in Arabidopsis. Plant Mol. Biol., 2003. 52(6): p. 1125-34 [PMID:14682613] Sarnowski TJ, et al. SWI3 subunits of putative SWI/SNF chromatin-remodeling complexes play distinct roles during Arabidopsis development. Plant Cell, 2005. 17(9): p. 2454-72 [PMID:16055636] Archacki R, et al. Genetic analysis of functional redundancy of BRM ATPase and ATSWI3C subunits of Arabidopsis SWI/SNF chromatin remodelling complexes. Planta, 2009. 229(6): p. 1281-92 [PMID:19301030] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Vercruyssen L, et al. ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development. Plant Cell, 2014. 26(1): p. 210-29 [PMID:24443518] Liu ZW, et al. Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis. PLoS Genet., 2016. 12(5): p. e1006026 [PMID:27171427]