PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4DS_CFC487CE5.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 145aa MW: 16273 Da PI: 8.0663 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 68.5 | 1e-21 | 53 | 108 | 2 | 58 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 +Dgy+W+KYGqK +k+ + rsY+rC ++C +kkkve + dp++ ++Y g H+h Traes_4DS_CFC487CE5.2 53 EDGYQWKKYGQKFIKNIQKIRSYFRCRDKRCGAKKKVEWQPGDPNL-RVVYDGAHQH 108 7****************************************99985.899******9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 18.234 | 47 | 111 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 5.0E-23 | 50 | 111 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.44E-20 | 50 | 111 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.4E-21 | 52 | 110 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.1E-20 | 53 | 108 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MYTMIHESYI SMYRWLICRG NEGGERGHHG DEEEQQQGAW AEAAGGQPLV MPEDGYQWKK 60 YGQKFIKNIQ KIRSYFRCRD KRCGAKKKVE WQPGDPNLRV VYDGAHQHGS PSSNGGGQDA 120 DGAANRYDLS TQYFGGAGAP TPQTQ |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ806389 | 1e-101 | JQ806389.1 Hordeum vulgare WRKY transcript factor 48 (WRKY48) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020162457.1 | 2e-89 | probable WRKY transcription factor 2 isoform X1 | ||||
Refseq | XP_020181477.1 | 2e-89 | probable WRKY transcription factor 2 isoform X1 | ||||
TrEMBL | A0A453H0T6 | 1e-88 | A0A453H0T6_AEGTS; Uncharacterized protein | ||||
STRING | Traes_4DS_CFC487CE5.2 | 1e-105 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10158 | 34 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29860.1 | 1e-14 | WRKY DNA-binding protein 71 |
Publications ? help Back to Top | |||
---|---|---|---|
|