PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4DL_D41CB81EA.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 145aa MW: 15759.8 Da PI: 11.7849 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.5 | 1.8e-19 | 10 | 54 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g+W++eEd llv +v+q+G ++W+ I++ ++ gRt+k+c++rw + Traes_4DL_D41CB81EA.1 10 GSWSPEEDALLVALVRQHGARRWSVISAGVP-GRTGKSCRLRWCNQ 54 89*****************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 53.5 | 5.6e-17 | 63 | 105 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T++Ed l++ a +++G++ W+ Iar ++ gRt++++k++w++ Traes_4DL_D41CB81EA.1 63 PFTAQEDALIIAAQARYGNK-WADIARLLP-GRTDNSVKNHWNSN 105 89******************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.842 | 1 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.9E-30 | 7 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-16 | 8 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-18 | 9 | 54 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.5E-25 | 10 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.96E-15 | 11 | 53 | No hit | No description |
PROSITE profile | PS51294 | 20.062 | 60 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 9.1E-15 | 60 | 108 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-14 | 63 | 105 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.75E-12 | 63 | 106 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-21 | 63 | 108 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MEMPAPIKTG SWSPEEDALL VALVRQHGAR RWSVISAGVP GRTGKSCRLR WCNQLSPAVQ 60 HRPFTAQEDA LIIAAQARYG NKWADIARLL PGRTDNSVKN HWNSNLRRCQ RRAKAMAAAA 120 AARAAASSSS SSGSAARAKT QQQEQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-37 | 10 | 108 | 5 | 103 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK374111 | 1e-150 | AK374111.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3054K02. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020177202.1 | 1e-101 | transcription factor MYB44-like | ||||
Swissprot | O23160 | 4e-47 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A3B6JPQ6 | 1e-100 | A0A3B6JPQ6_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A453IY50 | 1e-100 | A0A453IY50_AEGTS; Uncharacterized protein | ||||
STRING | Traes_4DL_D41CB81EA.1 | 1e-100 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP13544 | 27 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G23290.1 | 3e-50 | myb domain protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|