PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4DL_7CB8EC5A8.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 169aa MW: 19164 Da PI: 10.0995 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 157.1 | 7.6e-49 | 17 | 143 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 pGfrFhPt+eel+ +yL + + gkkl++ ++i +++iy+++PwdLp ++k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d+ Traes_4DL_7CB8EC5A8.1 17 PGFRFHPTEEELLGFYLSRVALGKKLHF-DIIGTLNIYRHDPWDLPGMAKIGEREWYFFVPRDRKAGSGGRPNRTTERGFWKATGSDR 103 9*************************99.99***************888999************************************ PP NAM 91 evlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ s+ ++++glkktLvfy+grap+g+ktdWvm+eyrl Traes_4DL_7CB8EC5A8.1 104 AIRSTgdPKRVIGLKKTLVFYQGRAPRGTKTDWVMNEYRL 143 ****8766778***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-58 | 10 | 163 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.723 | 15 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.4E-25 | 17 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MAMAVAASTM EVDQDLPGFR FHPTEEELLG FYLSRVALGK KLHFDIIGTL NIYRHDPWDL 60 PGMAKIGERE WYFFVPRDRK AGSGGRPNRT TERGFWKATG SDRAIRSTGD PKRVIGLKKT 120 LVFYQGRAPR GTKTDWVMNE YRLPDTGAAP PSEDTVLCKV YRKATPLKE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-50 | 17 | 165 | 17 | 170 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK367376 | 0.0 | AK367376.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2055P15. | |||
GenBank | AK367963 | 0.0 | AK367963.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2065K10. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020190294.1 | 1e-123 | NAC domain-containing protein 72-like | ||||
Swissprot | Q10S65 | 1e-107 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | A0A3B6JNX9 | 1e-121 | A0A3B6JNX9_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A453J381 | 1e-121 | A0A453J381_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453J3M7 | 1e-122 | A0A453J3M7_AEGTS; Uncharacterized protein | ||||
STRING | Traes_4DL_7CB8EC5A8.1 | 1e-122 | (Triticum aestivum) | ||||
STRING | TRIUR3_32216-P1 | 1e-121 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1770 | 38 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 2e-84 | NAC domain containing protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|