PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4BL_F49830790.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 129aa MW: 14741 Da PI: 10.8633 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.4 | 7e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+teEd +l + v+++G g+W+ I+r g R++k+c++rw++yl Traes_4BL_F49830790.1 14 RGPWSTEEDAKLMNHVAKHGLGRWSDIPRLAGIERCGKSCRLRWLNYL 61 89******************************66*************7 PP | |||||||
2 | Myb_DNA-binding | 39.4 | 1.4e-12 | 71 | 109 | 5 | 45 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++eE++l+++++ G+ W++Ia++++ gRt++ +k++w+ Traes_4BL_F49830790.1 71 SQEEEDLIIQLHSIIGNS-WTLIAACLP-GRTDNGVKNFWN 109 89**************99.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.598 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.17E-31 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.4E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.3E-24 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.05E-10 | 16 | 61 | No hit | No description |
SMART | SM00717 | 2.0E-8 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 15.533 | 66 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-20 | 69 | 116 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.5E-11 | 71 | 109 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.73E-8 | 71 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MSKAPRGPRK AVRRGPWSTE EDAKLMNHVA KHGLGRWSDI PRLAGIERCG KSCRLRWLNY 60 LRPDLKRAAL SQEEEDLIIQ LHSIIGNSWT LIAACLPGRT DNGVKNFWNA SIKHKLRRRG 120 IDPDTHEPM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-31 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020163437.1 | 2e-86 | myb-related protein Hv33-like | ||||
Refseq | XP_020163438.1 | 2e-86 | myb-related protein Hv33-like | ||||
Swissprot | Q8LPH6 | 5e-56 | MYB86_ARATH; Transcription factor MYB86 | ||||
TrEMBL | A0A3B6IVZ5 | 6e-90 | A0A3B6IVZ5_WHEAT; Uncharacterized protein | ||||
STRING | Traes_4BL_F49830790.1 | 1e-90 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26660.1 | 2e-58 | myb domain protein 86 |
Publications ? help Back to Top | |||
---|---|---|---|
|