PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_4BL_13069CE63.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bHLH

Protein Properties

Length: 95aa MW: 10676 Da PI: 7.3656

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_4BL_13069CE63.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	23.1	1.4e-07	23	62	15	54
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +i + ++L++llP+a ++ ++s + +L++++ YI+sL Traes_4BL_13069CE63.1 23 QISDLVSKLQDLLPEARLRGNDRVSSSRVLQETCTYIRSL 62 789999*******889******************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	9.896	8	62	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	5.0E-8	9	81	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	7.07E-9	22	84	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	8.7E-5	23	62	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009416	Biological Process	response to light stimulus
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MRLTQAPQSR SRQSGSSRIT DEQISDLVSK LQDLLPEARL RGNDRVSSSR VLQETCTYIR 60 SLHREVDDLS ERLSELLATS DMSSAQAAII RSLLM

Functional Description ? help Back to Top
Source	Description
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}.
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269\|PubMed:22363621}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK069569	5e-82	AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020177249.1	1e-45	transcription factor ILI6
Swissprot	B8APB5	2e-44	ILI6_ORYSI; Transcription factor ILI6
Swissprot	Q0DUR2	2e-44	ILI6_ORYSJ; Transcription factor ILI6
TrEMBL	A0A3B6IV13	7e-52	A0A3B6IV13_WHEAT; Uncharacterized protein
STRING	Traes_4BL_13069CE63.1	4e-59	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2675	33	78

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26945.1	2e-34	bHLH family protein

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]