PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4BL_0174177391.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 85aa MW: 9488.86 Da PI: 4.5217 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 127.9 | 3.7e-40 | 1 | 72 | 30 | 101 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101 +kadedv+misaeaPvl++kacelfilelt+rswlhaeenkrrtl+++d+aaa++rtd+fdflvdivpr+e Traes_4BL_0174177391.1 1 MKADEDVRMISAEAPVLFAKACELFILELTIRSWLHAEENKRRTLQRNDVAAAIARTDVFDFLVDIVPREEA 72 9********************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.36E-24 | 1 | 69 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.4E-30 | 1 | 69 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.9E-14 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MKADEDVRMI SAEAPVLFAK ACELFILELT IRSWLHAEEN KRRTLQRNDV AAAIARTDVF 60 DFLVDIVPRE EAKEEPGSAA LGFAA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 1e-39 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 41 | 47 | RRTLQRN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:26542958). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:26542958}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases at the end of the dark period, peaks in the beginning of the light period and gradually decreases during daytime. {ECO:0000269|PubMed:26542958}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM078729 | 1e-131 | KM078729.1 Triticum aestivum CCAAT-binding transcription factor C (NFYC-D5) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020154990.1 | 7e-55 | nuclear transcription factor Y subunit C-2-like | ||||
Swissprot | A6BLW4 | 1e-49 | NFYC2_ORYSJ; Nuclear transcription factor Y subunit C-2 | ||||
TrEMBL | A0A446QQS3 | 5e-54 | A0A446QQS3_TRITD; Uncharacterized protein | ||||
STRING | TRIUR3_09240-P1 | 1e-54 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7345 | 35 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63470.2 | 7e-48 | nuclear factor Y, subunit C4 |
Publications ? help Back to Top | |||
---|---|---|---|
|