PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4AL_286F71214.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 80aa MW: 9096.45 Da PI: 10.1699 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 33.8 | 6.2e-11 | 21 | 58 | 58 | 95 |
EEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS B3 58 ryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 ++lt+GW++Fv+an++++gD ++F + grs+f+ ++k Traes_4AL_286F71214.1 21 LITLTTGWRHFVDANHIRQGDPIMFVYCGRSTFKVHFK 58 478******************************88776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 10.574 | 1 | 61 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 9.77E-8 | 2 | 57 | No hit | No description |
Pfam | PF02362 | 2.3E-8 | 3 | 58 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.8E-10 | 13 | 57 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 3.0E-9 | 20 | 57 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
PIKLETPDIH VYSVEFVKFG LITLTTGWRH FVDANHIRQG DPIMFVYCGR STFKVHFKGT 60 PSGHKNSLPS SQQPPNIFRA |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020170061.1 | 2e-23 | B3 domain-containing protein LOC_Os12g40080-like | ||||
TrEMBL | T1LM33 | 3e-47 | T1LM33_TRIUA; Uncharacterized protein | ||||
STRING | Traes_4AL_286F71214.1 | 6e-54 | (Triticum aestivum) |
Publications ? help Back to Top | |||
---|---|---|---|
|