PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DS_DF23FE973.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 104aa MW: 12012.5 Da PI: 12.1749 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.9 | 2.6e-14 | 28 | 72 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+ E+ l++ + k++G g+W+ I+r + ++Rt+ q+ s+ qky Traes_3DS_DF23FE973.1 28 PWTEHEHRLFLLGLKKYGRGDWRNISRNFVQTRTPTQVASHAQKY 72 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.151 | 21 | 77 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.5E-17 | 23 | 77 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.0E-17 | 25 | 75 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.2E-11 | 25 | 75 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.4E-12 | 27 | 71 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.2E-11 | 28 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.26E-11 | 28 | 73 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
QARRRFGVGC GNWHGVRTPE RGRRRGVPWT EHEHRLFLLG LKKYGRGDWR NISRNFVQTR 60 TPTQVASHAQ KYFIRLSSGV ARRSSIHDIT TVHLTDDQPP APSQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF951954 | 1e-176 | JF951954.1 Aegilops tauschii clone TaMYB71 MYB-related protein mRNA, complete cds. | |||
GenBank | KU857038 | 1e-176 | KU857038.1 Triticum aestivum GID2 protein isoform 3 (gid2) mRNA, complete cds. | |||
GenBank | KU857043 | 1e-176 | KU857043.1 Aegilops tauschii GID2 protein (gid2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020200806.1 | 4e-71 | F-box protein GID2-like | ||||
Swissprot | Q8S9H7 | 3e-40 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | M8BUC9 | 5e-70 | M8BUC9_AEGTA; F-box protein GID2 | ||||
STRING | EMT28630 | 9e-71 | (Aegilops tauschii) | ||||
STRING | Traes_3DS_DF23FE973.1 | 2e-71 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7886 | 33 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 5e-40 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|